RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G344820
Reference: TK1151 Chr: Chr03 Coordinates: 84855077-84856549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1254 bp · TkA03G344820|TK1151|cDNA

ATGTCGAATTTGATCCAAGAAACTGATCAAGAATTGAAGAAACACTCATGTAAGCTGTGCGATAAGAGCTTCCCTTCTGGTAGATCGTTAGGAGGTCACATGCGGTCTCACGTGATCAACTCCCCCGATCATCATCATCAACAACAGAAACAGATGAAGAAATTGTCTTCCGTCGGCAATGGCGGAAAATCAACGAAGAACGATACTTGTTACGAGCTACGCAAAGATCCAAAAAAGACTCCGAAAGTCAAAGATTCAAG...

CDS

Download CDS FASTA

1254 bp · TkA03G344820|TK1151|CDS

ATGTCGAATTTGATCCAAGAAACTGATCAAGAATTGAAGAAACACTCATGTAAGCTGTGCGATAAGAGCTTCCCTTCTGGTAGATCGTTAGGAGGTCACATGCGGTCTCACGTGATCAACTCCCCCGATCATCATCATCAACAACAGAAACAGATGAAGAAATTGTCTTCCGTCGGCAATGGCGGAAAATCAACGAAGAACGATACTTGTTACGAGCTACGCAAAGATCCAAAAAAGACTCCGAAAGTCAAAGATTCAAG...

Protein

Download Protein FASTA

417 aa · TkA03G344820|TK1151|PROTEIN

MSNLIQETDQELKKHSCKLCDKSFPSGRSLGGHMRSHVINSPDHHHQQQKQMKKLSSVGNGGKSTKNDTCYELRKDPKKTPKVKDSSEIENNNSCLVVLDKLCKECGKGFQSWKALFGHMKCHSEKVANNNNLNHDSWTGQSDNENSRPIKKSKSRNGKIKRYKVTSVTTTTITTTSSSISINANNNNNTSTSVVSEIEQDQESEIAMCLMMLSRDEGKWGNEFESSDQEFNDESELVFGSKRKFECITCNKSFDSYQAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G344820
TK1151 IDTkA03G344820
OH-1004 IDLXL04_008680
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)80.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G344820
LocationChr03:84855077-84856549 (+)
DescriptionSimilar to ZAT9: Zinc finger protein ZAT9
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g60580 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release
At4g35280 Mediates the regulation of male germ cell division by DUO1.
An EAR-Dependent Regulatory Module Promotes Male Germ Cell Division and Sperm Fertility in Arabidopsis.2014 · DOI: 10.1105/tpc.114.124743
At3g19580 Transcriptional repressor involved in the inhibition of plant growth under abiotic stress conditions.
Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast.2000 · DOI: 10.1046/j.1365-313x.2000.00809.x
Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions.2004 · DOI: 10.1104/pp.104.046599
Mapping methyl jasmonate-mediated transcriptional reprogramming of metabolism and cell cycle progression in cultured Arabidopsis cells.2008 · DOI: 10.1073/pnas.0711203105
Arabidopsis zinc-finger protein 2 is a negative regulator of ABA signaling during seed germination.2010 · DOI: 10.1016/j.jplph.2010.05.010
Arabidopsis Cys2/His2 zinc-finger proteins AZF1 and AZF2 negatively regulate abscisic acid-repressive and auxin-inducible genes under abiotic stress conditions.2011 · DOI: 10.1104/pp.111.182683
Gene network analysis and functional studies of senescence-associated genes reveal novel regulators of Arabidopsis leaf senescence.2012 · DOI: 10.1111/j.1744-7909.2012.01136.x
At2g28200 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release
At5g04340 Probable transcription factor that regulates root development and phosphate (Pi) acquisition and homeostasis.
Phosphate homeostasis and root development in Arabidopsis are synchronized by the zinc finger transcription factor ZAT6.2007 · DOI: 10.1104/pp.107.101691

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008680 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006950 response to stress Biological Process
GO:0009617 response to bacterium Biological Process
GO:0010200 response to chitin Biological Process
GO:0048235 pollen sperm cell differentiation Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0071731 response to nitric oxide Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
KEGG gene cross-reference
ath:AT1G02030
ath:AT2G45120
ath:AT3G46080
ath:AT3G60580
ath:AT4G35280
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.984
Rank 1 · TkA03G344820 · TK1151
Cytoplasm0.062
Rank 2 · TkA03G344820 · TK1151
Cell membrane0.021
Rank 3 · TkA03G344820 · TK1151
Endoplasmic reticulum0.011
Rank 4 · TkA03G344820 · TK1151
Plastid0.008
Rank 5 · TkA03G344820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12756zf-C2H2_23-51 aa
PF27966ZNF4287-37 aa
PF25420zf-C2H2_ZN2928-24 aa
PF23455DUF712913-22 aa
PF12171zf-C2H2_jaz14-37 aa
PF13912zf-C2H2_615-37 aa
PF13894zf-C2H2_415-37 aa
PF00096zf-C2H215-37 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G344820PF12756zf-C2H2_23511e-0629.6
TkA03G344820PF27966ZNF4287370.3611.7
TkA03G344820PF25420zf-C2H2_ZN2928240.1512.9
TkA03G344820PF23455DUF712913220.7110.4
TkA03G344820PF12171zf-C2H2_jaz14377.1e-0936.3
TkA03G344820PF13912zf-C2H2_615379e-40134.6
TkA03G344820PF13894zf-C2H2_415372.3e-1453.4
TkA03G344820PF00096zf-C2H215371.4e-0835.4
TkA03G344820PF12874zf-met16371.3e-0835.5
TkA03G344820PF25299ZZ_ADA216370.02215.6
TkA03G344820PF08790zf-LYAR16260.2312.1
TkA03G344820PF18112Zn-C2H2_1217270.001120.0
TkA03G344820PF22034B129_C2H2-zf17240.1213.4
TkA03G344820PF23103Zf-C2H2_ZNF451_5th17314.77.8
TkA03G344820PF15909zf-C2H2_818390.03915.0
TkA03G344820PF23101Zf-C2H2_ZNF451_1st20350.003917.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M202Arabidopsis thalianasp|Q9M202|ZAT9_ARATH Zinc finger protein ZAT925.600%Swiss-ProtLow
O65499Arabidopsis thalianasp|O65499|ZAT3_ARATH Zinc finger protein ZAT330.400%Swiss-ProtMedium
Q9SSW2Arabidopsis thalianasp|Q9SSW2|AZF2_ARATH Zinc finger protein AZF230.000%Swiss-ProtLow
Q681X4Arabidopsis thalianasp|Q681X4|ZAT5_ARATH Zinc finger protein ZAT532.400%Swiss-ProtLow
O22533Arabidopsis thalianasp|O22533|ZAT6_ARATH Zinc finger protein ZAT635.800%Swiss-ProtLow

JBrowse

View in Genome Browser