TkA03G184050 | RubberDandelionOmics

Gene overview

TkA03G184050

Reference: TK1151 Chr: Chr03 Coordinates: 46328206-46333599 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4483 bp · TkA03G184050|TK1151|cDNA

TAATTAGTCATTTTCTTTATTATAAAAACAATTGACATATATGTCATAGCTTACAAAAAATGTTAACTTGTTTAAATGTTTTGTTACCCCATTTATAGCGTTTGTGTTGGATCTTGTATAGACATATGTATGTGGCTAACCTCTTTTTGTTATATAAATGGATAACACTTAAGATCTTGACAAATATCCTTCGATTTTCGTTAGAAATAATAAAACATTCCAGTGTCTAACGTGCAGGCCATTGCGGTCGCTAATTTCAC...

CDS

Download CDS FASTA

3573 bp · TkA03G184050|TK1151|CDS

ATGACTTCCAATCGCCCACTTCCGGGCCCCTCCCTCCGAACTCCAGGATCTGTTGGGTCCGATCGTTCTTCGTCGATTTCCAGTAAGAACTCAGATAATGCCCAGATTGCAAATCTACACCTACATGAACGACTAGATACCTTGCAAAATTCGTCTTCTCAGCAAAGCATTAAGTCGAAAAGCTGGAGGGCAACCTCTGTAAATTTCGGATCAAAGGGTGTGCGACATGGATCTCGAAGTGGTGCCGATTCTGAAGGGTT...

Protein

Download Protein FASTA

1190 aa · TkA03G184050|TK1151|PROTEIN

MTSNRPLPGPSLRTPGSVGSDRSSSISSKNSDNAQIANLHLHERLDTLQNSSSQQSIKSKSWRATSVNFGSKGVRHGSRSGADSEGFSMSRREFNDDDARLVYVNDPLKTNDTFEFSGNSIRTGKYSVLTFLPRNLFEQFHRVAYMYFLIIAILNQLPQLAVFGRGASILPLASVLLVTAIKDAYEDWRRHKSDKIENNKTSSVLINDRFQPKKWKDIQVGEVIKILANETIPCDLVLLSTSDPTGVAYVQTINLDGESN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G184050`
TK1151 ID	TkA03G184050
OH-1004 ID	LXL04_007493
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G184050

Location Chr03:46328206-46333599 (+)

Description Similar to ALA1: Phospholipid-transporting ATPase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04930`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007493 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010996 response to auditory stimulus Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G59820

ath:AT5G04930

hsa:10396

hsa:51761

mmu:11980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.348

Rank 1 · TkA03G184050 · TK1151

Endoplasmic reticulum0.271

Rank 2 · TkA03G184050 · TK1151

Golgi apparatus0.206

Rank 3 · TkA03G184050 · TK1151

Lysosome / Vacuole0.196

Rank 4 · TkA03G184050 · TK1151

Cytoplasm0.195

Rank 5 · TkA03G184050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209PhoLip_ATPase_N102-168 aa

PF00122E1-E2_ATPase200-264 aa

PF16212PhoLip_ATPase_C414-430 aa

PF00702Hydrolase482-501 aa

PF13246Cation_ATPase592-757 aa

PF00702Hydrolase714-786 aa

PF08282Hydrolase_3761-787 aa

PF08282Hydrolase_3879-907 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G184050	`PF16209`	PhoLip_ATPase_N	102	168	3.4e-24	85.1
TkA03G184050	`PF00122`	E1-E2_ATPase	200	264	0.00041	20.8
TkA03G184050	`PF16212`	PhoLip_ATPase_C	414	430	6.7e-75	252.8
TkA03G184050	`PF00702`	Hydrolase	482	501	5.5e-09	37.4
TkA03G184050	`PF13246`	Cation_ATPase	592	757	4.8e-13	50.0
TkA03G184050	`PF00702`	Hydrolase	714	786	5.5e-09	37.4
TkA03G184050	`PF08282`	Hydrolase_3	761	787	0.00035	21.1
TkA03G184050	`PF08282`	Hydrolase_3	879	907	0.00035	21.1
TkA03G184050	`PF00702`	Hydrolase	883	903	5.5e-09	37.4
TkA03G184050	`PF16212`	PhoLip_ATPase_C	917	1156	6.7e-75	252.8
TkA03G184050	`PF16209`	PhoLip_ATPase_N	1134	1145	3.4e-24	85.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P98204`	Arabidopsis thaliana	sp\|P98204\|ALA1_ARATH Phospholipid-transporting ATPase 1	69.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card