Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3573 bp · LXL04_007493|LXL04_007493|OH1004|cDNA
ATGACTTCCAATCGCCCACTTCCGGGCCCCTCCCTCCGAACTCCAGGATCTGCTGGGTCCGATCGTTCTTCATCGATTTCCAGTAAGAACTCAGATAATGCCCAGATTGCAAATCTACACCTACATGAACGACTAGATACCTTGCAAAATTCGTCTTCTCAGCAAAGCATTAAGTCGAACAGCTGGAGGGCAACCTCTGTAAATTTTGGATCAAAGGGTGTGCGACATGGATCTCGAAGTGGTGCCGATTCAGAAGGGTT...
3573 bp · LXL04_007493|LXL04_007493|OH1004|CDS
ATGACTTCCAATCGCCCACTTCCGGGCCCCTCCCTCCGAACTCCAGGATCTGCTGGGTCCGATCGTTCTTCATCGATTTCCAGTAAGAACTCAGATAATGCCCAGATTGCAAATCTACACCTACATGAACGACTAGATACCTTGCAAAATTCGTCTTCTCAGCAAAGCATTAAGTCGAACAGCTGGAGGGCAACCTCTGTAAATTTTGGATCAAAGGGTGTGCGACATGGATCTCGAAGTGGTGCCGATTCAGAAGGGTT...
Protein
Download Protein FASTA1190 aa · LXL04_007493|LXL04_007493|OH1004|PROTEIN
MTSNRPLPGPSLRTPGSAGSDRSSSISSKNSDNAQIANLHLHERLDTLQNSSSQQSIKSNSWRATSVNFGSKGVRHGSRSGADSEGFSMSRREFNDDDARLVYVNDPLKTNETFEFSGNSIRTGKYSVFTFLPRNLFEQFHRVAYMYFLIIAILNQLPQLAVFGRGASILPLASVLLVTAIKDAYEDWRRHKSDKIENNKTSSVLINDRFQPKKWKDIQVGEVIKILANETIPCDLVLLSTSDPTGVAYVQTINLDGESN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007493 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007493 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:50522545-50526970 (+) | |||||||||
| Description | Similar to ALA1: Phospholipid-transporting ATPase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0002238 response to molecule of fungal origin Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0008104 intracellular protein localization Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0009860 pollen tube growth Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010996 response to auditory stimulus Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0030335 positive regulation of cell migration Biological Process GO:0034220 monoatomic ion transmembrane transport Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G59820 ath:AT5G04930 hsa:10396 hsa:51761 mmu:11980 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16209.11PhoLip_ATPase_N102-168 aaPF13246.13Cation_ATPase592-757 aaPF00702.33Hydrolase714-786 aaPF16212.12PhoLip_ATPase_C917-1156 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_007493 | PF16209.11 | PhoLip_ATPase_N | 102 | 168 | 2.5e-24 | 85.5 |
| LXL04_007493 | PF13246.13 | Cation_ATPase | 592 | 757 | 4.5e-13 | 50.1 |
| LXL04_007493 | PF00702.33 | Hydrolase | 714 | 786 | 5.2e-09 | 37.5 |
| LXL04_007493 | PF16212.12 | PhoLip_ATPase_C | 917 | 1156 | 1.3e-74 | 251.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.