RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G062600
Reference: TK1151 Chr: Chr03 Coordinates: 16149442-16152694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1640 bp · TkA03G062600|TK1151|cDNA

GATAGTATAAACAAGAAGAAAGAGGAACGCCATCTCGTACCTGTTCACGCTTGTCGTGATACTACTAATAGCCGTCCTTTGATGGCCGTAAGGCCTCCTCTGCAATTCACCGCATCCTCAATCAACGCCATCAAATTACCTTTCAACCCACCCACCGCCACCATTTCCCGATTCACCGTCGTATTCATCCGCCGCTTCGCCTCCGCCGGTATTCGTCTGACCGGTGTTGTTCCCCCGCAGCAACACATCAACCAGAAACA...

CDS

Download CDS FASTA

1323 bp · TkA03G062600|TK1151|CDS

ATGGCCGTAAGGCCTCCTCTGCAATTCACCGCATCCTCAATCAACGCCATCAAATTACCTTTCAACCCACCCACCGCCACCATTTCCCGATTCACCGTCGTATTCATCCGCCGCTTCGCCTCCGCCGGTATTCGTCTGACCGGTGTTGTTCCCCCGCAGCAACACATCAACCAGAAACACAATCGATACAGATATTCCTATCAAGAAACCCTAGTTCAACCGCCTATTTCGTCACTATCTCCGTCGTATCGCCTCCACCC...

Protein

Download Protein FASTA

440 aa · TkA03G062600|TK1151|PROTEIN

MAVRPPLQFTASSINAIKLPFNPPTATISRFTVVFIRRFASAGIRLTGVVPPQQHINQKHNRYRYSYQETLVQPPISSLSPSYRLHPASSLQEKLAQKIGKASRHPGAPSKARVYADVNVVRPKEYWDYESLTVQWGEQDDYEVVRKVGRGKYSEVFEGLHSIDDEKCIIKILKPVKKKKIKREIKILQNLCGGPNIIKLLDIVRDQQSKTPSLIFEHVNNTDFKILYPTLSDFDIRYYIYELLKALEYCHSQGIMHRDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G062600
TK1151 IDTkA03G062600
OH-1004 IDLXL04_013611
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)79.400
Protein coverage (%)TK1151 100.000 / OH-1004 97.072
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G062600
LocationChr03:16149442-16152694 (-)
DescriptionSimilar to CKA4: Casein kinase II subunit alpha-4, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g23070 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.
Plastid casein kinase 2 knockout reduces abscisic acid (ABA) sensitivity, thermotolerance, and expression of ABA- and heat-stress-responsive nuclear genes.2014 · DOI: 10.1093/jxb/eru190
A mutation of casein kinase 2 α4 subunit affects multiple developmental processes in Arabidopsis.2016 · DOI: 10.1007/s00299-016-1939-5
At3g50000 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates (By similarity). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: Q9AR27 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. No verified direct reference in this release
UniProt: B6F107 Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013611 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006281 DNA repair Biological Process
GO:0006325 chromatin organization Biological Process
GO:0006974 DNA damage response Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009648 photoperiodism Biological Process
GO:0009908 flower development Biological Process
GO:0010019 chloroplast-nucleus signaling pathway Biological Process
GO:0010187 negative regulation of seed germination Biological Process
GO:0010225 response to UV-C Biological Process
GO:0010229 inflorescence development Biological Process
GO:0010332 response to gamma radiation Biological Process
GO:0040008 regulation of growth Biological Process
KEGG gene cross-reference
ath:AT2G23070
ath:AT5G67380
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518
Rank 1 · TkA03G062600 · TK1151
Nucleus0.462
Rank 2 · TkA03G062600 · TK1151
Mitochondrion0.088
Rank 3 · TkA03G062600 · TK1151
Cell membrane0.072
Rank 4 · TkA03G062600 · TK1151
Endoplasmic reticulum0.045
Rank 5 · TkA03G062600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase142-427 aa
PF07714PK_Tyr_Ser-Thr144-342 aa
PF03109ABC1156-191 aa
PF17667Pkinase_fungal156-192 aa
PF01636APH169-247 aa
PF17667Pkinase_fungal245-318 aa
PF03109ABC1247-292 aa
PF06293Kdo250-279 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G062600PF00069Pkinase1424277.3e-62209.8
TkA03G062600PF07714PK_Tyr_Ser-Thr1443421.8e-1764.2
TkA03G062600PF03109ABC11561910.0006819.6
TkA03G062600PF17667Pkinase_fungal1561920.00118.6
TkA03G062600PF01636APH1692472e-0628.5
TkA03G062600PF17667Pkinase_fungal2453180.00118.6
TkA03G062600PF03109ABC12472920.0006819.6
TkA03G062600PF06293Kdo2502790.07113.3
TkA03G062600PF01636APH2522952e-0628.5
TkA03G062600PF01633Choline_kinase2552820.211.7
TkA03G062600PF01636APH3754172e-0628.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O64816Arabidopsis thalianasp|O64816|CSK2P_ARATH Casein kinase II subunit alpha-4, chloroplastic76.500%Swiss-ProtHigh
Q08466Arabidopsis thalianasp|Q08466|CSK22_ARATH Casein kinase II subunit alpha-286.100%Swiss-ProtHigh
Q9AR27Oryza sativa subsp. indicasp|Q9AR27|HD6_ORYSI Casein kinase II subunit alpha-287.900%Swiss-ProtHigh
B6F107Oryza sativa subsp. japonicasp|B6F107|HD6_ORYSJ Casein kinase II subunit alpha-287.900%Swiss-ProtHigh

JBrowse

View in Genome Browser