LXL04_013611 | RubberDandelionOmics

Gene overview

LXL04_013611

Reference: OH-1004 Chr: Chr03 Coordinates: 32638986-32641528 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · LXL04_013611|LXL04_013611|OH1004|cDNA

aagaagataaaaaggaaaaggaaaagtGTAGTCaggaaaaataaaaagaaaggGTTGCGATCTCAGGTCGTGTTCTTGATTATAACCCGTTTGATGGCCGTAAGGCCTTCGCTGCACTTCATCGCCTCCTCAATCAACATCGCCAAATACCCCCTTTCCTCCATTTCCCCATCGTCAACACTACTTCTCCGCCACATCGCATCTGCCGCTCCACCTCAACAACACCAGCGaaagcaaaagcaaaagcaCAAATATCCTCA...

CDS

Download CDS FASTA

1335 bp · LXL04_013611|LXL04_013611|OH1004|CDS

TTGCGATCTCAGGTCGTGTTCTTGATTATAACCCGTTTGATGGCCGTAAGGCCTTCGCTGCACTTCATCGCCTCCTCAATCAACATCGCCAAATACCCCCTTTCCTCCATTTCCCCATCGTCAACACTACTTCTCCGCCACATCGCATCTGCCGCTCCACCTCAACAACACCAGCGAAAGCAAAAGCAAAAGCACAAATATCCTCATCAAAACCCCCTCCGTCAGCCGCCTACGTCACCTCCACTTTCAACTCCATCTTA...

Protein

Download Protein FASTA

444 aa · LXL04_013611|LXL04_013611|OH1004|PROTEIN

MRSQVVFLIITRLMAVRPSLHFIASSINIAKYPLSSISPSSTLLLRHIASAAPPQQHQRKQKQKHKYPHQNPLRQPPTSPPLSTPSYSLRPTVSLQETLAQKIGKAIRRPGAPSKARVYTDVNVIRPKEYWDYESLTVQWGEQDNYEVVRKVGRGKYSEVFEGFHCTNDEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQQSKTPSLIFEYVNNTDFKVLYPTLSDVDIRYYIYELLKALDYCHSQGIM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013611`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013611

Location Chr03:32638986-32641528 (+)

Description Similar to CKA4: Casein kinase II subunit alpha-4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23070`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Plastid casein kinase 2 knockout reduces abscisic acid (ABA) sensitivity, thermotolerance, and expression of ABA- and heat-stress-responsive nuclear genes.2014 · DOI: 10.1093/jxb/eru190 A mutation of casein kinase 2 α4 subunit affects multiple developmental processes in Arabidopsis.2016 · DOI: 10.1007/s00299-016-1939-5
`At5g67380`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Cloning and characterization of two cDNAs encoding casein kinase II catalytic subunits in Arabidopsis thaliana.1993 · DOI: 10.1007/bf00019944 Reconstitution of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of transcription factor GBF1.1995 · DOI: 10.1105/tpc.7.1.105

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B6F107`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`UniProt: Q9AR27`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013611 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009908 flower development Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0040008 regulation of growth Biological Process

KEGG gene cross-reference

ath:AT2G23070

ath:AT5G67380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.669

Rank 1 · LXL04_013611 · OH-1004

Cytoplasm0.202

Rank 2 · LXL04_013611 · OH-1004

Nucleus0.169

Rank 3 · LXL04_013611 · OH-1004

Cell membrane0.035

Rank 4 · LXL04_013611 · OH-1004

Plastid0.032

Rank 5 · LXL04_013611 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase146-431 aa

PF07714.24PK_Tyr_Ser-Thr148-345 aa

PF01636.30APH257-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013611	`PF00069.32`	Pkinase	146	431	2.3e-62	211.5
LXL04_013611	`PF07714.24`	PK_Tyr_Ser-Thr	148	345	4.3e-19	69.5
LXL04_013611	`PF01636.30`	APH	257	295	1.6e-07	32.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64816`	Arabidopsis thaliana	Casein kinase II subunit alpha-4, chloroplastic	91.329%	Swiss-Prot	strong database homology
`Q08467`	Arabidopsis thaliana	Casein kinase II subunit alpha-1	87.387%	Swiss-Prot	strong database homology
`B6F107`	Oryza sativa subsp. japonica	Casein kinase II subunit alpha-2	88.788%	Swiss-Prot	strong database homology
`Q9AR27`	Oryza sativa subsp. indica	Casein kinase II subunit alpha-2	88.788%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card