TkA03G060000 | RubberDandelionOmics

Gene overview

TkA03G060000

Reference: TK1151 Chr: Chr03 Coordinates: 15423167-15427604 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1781 bp · TkA03G060000|TK1151|cDNA

ATGAAGCACGTAGGATACGAACCCGCAGGAAAGCGCGTGGACGGGACCGGCTGCGTCGTACTCTTTCCTTTTTGATCCCTCAAGGATCCAAAGACCAATCCGCCCTTTGTTACAAGTGATAGATTGGTGGCGTAAACCACGGCGGACGGTGGTGGCGCCGTTGATCTCAACGAGCTTGTAAGAATCGGTGGATTTACTTAGCCTGATTACACACAAATATACAAAGAGATTGACGAGGTTTACGTTTCAAAGAACCAAAT...

CDS

Download CDS FASTA

1137 bp · TkA03G060000|TK1151|CDS

ATGGGAAGCAGCTACGACGAAAGCCCAATGGTTGTCAAACAGGATGAACCAGTGCCTCCTCCGTTACCAGCTCCATCATCGACGACAACCGTACTGACACGACGGCCGGCGTGTAGACGGAGAATCTGCTGTGTCACCGCGGCCACGACGGAGATATGGGATAGTTTATTCGATGATGCTTATAGAGCAGATGTTTCGATTCATACAACTAGTAACGACGTCATCTACGCACATTCTAGCATCCTCGGACTGGCGTCGCC...

Protein

Download Protein FASTA

378 aa · TkA03G060000|TK1151|PROTEIN

MGSSYDESPMVVKQDEPVPPPLPAPSSTTTVLTRRPACRRRICCVTAATTEIWDSLFDDAYRADVSIHTTSNDVIYAHSSILGLASPVFRTMFKRMGKNKKQFKQFAVPIRGVPTEAVRVFVRFLYSSCYEENQMEEHILSLLVLSHSFVVPRLKRECESQLEHKFLNVDNAVDVFQLALLCDAPRLSIICHRLIIKNLKAVSLSDGWKAMKESHPVLEKELLATVADESNREKEKEKKKKERKVYSDLYEAMEALVHIC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G060000`
TK1151 ID	TkA03G060000
OH-1004 ID	LXL04_006712
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G060000

Location Chr03:15423167-15427604 (+)

Description Similar to BT4: BTB/POZ and TAZ domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67480`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g37610`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g05690`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g63160`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g16710`	Acetyltransferase enzyme.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G05690

ath:AT3G48360

ath:AT4G37610

ath:AT5G63160

ath:AT5G67480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.522

Rank 1 · TkA03G060000 · TK1151

Cytoplasm0.424

Rank 2 · TkA03G060000 · TK1151

Cell membrane0.096

Rank 3 · TkA03G060000 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA03G060000 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA03G060000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02135zf-TAZ37-43 aa

PF00651BTB62-165 aa

PF24570BACK_BPM_SPOP149-158 aa

PF00651BTB170-198 aa

PF24570BACK_BPM_SPOP177-223 aa

PF26143ATRX_C177-256 aa

PF02135zf-TAZ251-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G060000	`PF02135`	zf-TAZ	37	43	2.1e-11	44.8
TkA03G060000	`PF00651`	BTB	62	165	2.5e-13	50.9
TkA03G060000	`PF24570`	BACK_BPM_SPOP	149	158	0.0046	17.8
TkA03G060000	`PF00651`	BTB	170	198	2.5e-13	50.9
TkA03G060000	`PF24570`	BACK_BPM_SPOP	177	223	0.0046	17.8
TkA03G060000	`PF26143`	ATRX_C	177	256	0.005	18.0
TkA03G060000	`PF02135`	zf-TAZ	251	335	2.1e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJX5`	Arabidopsis thaliana	sp\|Q9FJX5\|BT4_ARATH BTB/POZ and TAZ domain-containing protein 4	55.700%	Swiss-Prot	High
`Q6EJ98`	Arabidopsis thaliana	sp\|Q6EJ98\|BT5_ARATH BTB/POZ and TAZ domain-containing protein 5	57.100%	Swiss-Prot	High
`Q9SYL0`	Arabidopsis thaliana	sp\|Q9SYL0\|BT3_ARATH BTB/POZ and TAZ domain-containing protein 3	45.300%	Swiss-Prot	Medium
`Q9FMK7`	Arabidopsis thaliana	sp\|Q9FMK7\|BT1_ARATH BTB/POZ and TAZ domain-containing protein 1	42.800%	Swiss-Prot	Medium
`Q9FWQ5`	Arabidopsis thaliana	sp\|Q9FWQ5\|HAC12_ARATH Histone acetyltransferase HAC12	42.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card