LXL04_006712 | RubberDandelionOmics

Gene overview

LXL04_006712

Reference: OH-1004 Chr: Chr02 Coordinates: 22724619-22726479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · LXL04_006712|LXL04_006712|OH1004|cDNA

ATGGGAAGCAGCTACGACGAAAGCCCAATGGTTGTCAAACAGGATGAACCAGTGCCTCCTCCGTTACCGGCTCCATCATCGACGACAACCGTACTGACACGACGGCCGGCGTGTAGACGGAGAATCTGCTGTGTCACCGCGGCCACGACGGAGATATGGGATAGTTTATTCGATGATGCTTATAGAGCAGATGTTTCGATTCATACAACTAGTAACGACGTCATCTACGCACATTCTAGCATCCTCGGACTGGCGTCGCC...

CDS

Download CDS FASTA

1137 bp · LXL04_006712|LXL04_006712|OH1004|CDS

ATGGGAAGCAGCTACGACGAAAGCCCAATGGTTGTCAAACAGGATGAACCAGTGCCTCCTCCGTTACCGGCTCCATCATCGACGACAACCGTACTGACACGACGGCCGGCGTGTAGACGGAGAATCTGCTGTGTCACCGCGGCCACGACGGAGATATGGGATAGTTTATTCGATGATGCTTATAGAGCAGATGTTTCGATTCATACAACTAGTAACGACGTCATCTACGCACATTCTAGCATCCTCGGACTGGCGTCGCC...

Protein

Download Protein FASTA

378 aa · LXL04_006712|LXL04_006712|OH1004|PROTEIN

MGSSYDESPMVVKQDEPVPPPLPAPSSTTTVLTRRPACRRRICCVTAATTEIWDSLFDDAYRADVSIHTTSNDVIYAHSSILGLASPVFRTMFKRMGKNKKQFKQFAVPIRGVPTEAVRVFVRFLYSSCYEENQMEEHILSLLVLSHSFVVPRLKRECESQLEHKFLNVDNAVDVFQLALLCDAPRLSIICHRLIIKNLKAVSLSDGWKSMKESHPILEKELLATVADEANREKEKEKKKKERKVYSDLYEAMEALVHIC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006712`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006712

Location Chr02:22724619-22726479 (+)

Description Similar to BT4: BTB/POZ and TAZ domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67480`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g37610`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g05690`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g63160`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g48360`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006712 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G05690

ath:AT3G48360

ath:AT4G37610

ath:AT5G63160

ath:AT5G67480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.504

Rank 1 · LXL04_006712 · OH-1004

Cytoplasm0.441

Rank 2 · LXL04_006712 · OH-1004

Cell membrane0.099

Rank 3 · LXL04_006712 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_006712 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_006712 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB62-165 aa

PF02135.22zf-TAZ251-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006712	`PF00651.38`	BTB	62	165	2.6e-13	50.8
LXL04_006712	`PF02135.22`	zf-TAZ	251	335	2.1e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJX5`	Arabidopsis thaliana	BTB/POZ and TAZ domain-containing protein 4	56.510%	Swiss-Prot	strong database homology
`Q6EJ98`	Arabidopsis thaliana	BTB/POZ and TAZ domain-containing protein 5	57.143%	Swiss-Prot	strong database homology
`Q9SYL0`	Arabidopsis thaliana	BTB/POZ and TAZ domain-containing protein 3	46.459%	Swiss-Prot	moderate database homology
`Q9FMK7`	Arabidopsis thaliana	BTB/POZ and TAZ domain-containing protein 1	41.456%	Swiss-Prot	moderate database homology
`Q94BN0`	Arabidopsis thaliana	BTB/POZ and TAZ domain-containing protein 2	40.190%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card