TkA03G007040 | RubberDandelionOmics

Gene overview

TkA03G007040

Reference: TK1151 Chr: Chr03 Coordinates: 1691704-1694184 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · TkA03G007040|TK1151|cDNA

ATGAGAGTAGGTAAAGCCGTCGCCACAGTTGCTGCTCATAGGGTATTTCGCTGCGAATCCCTTTCAACCAAAAGTCTAAATACTCCAGCGAACTTGTGCTCTTCTCCTATTTCTGATACCACCATCTCGCCGGAACTTCGAAAGATGCCTTCAGCGGTGGAAGCTAAGATCGCGCCGTCGATGCTATCGTCGGACTTCGCCAATCTGGCATCAGAGGCTGAGCGCATGGTCAGCTTCGGTGCCGATTGGCTTCACATGGA...

CDS

Download CDS FASTA

903 bp · TkA03G007040|TK1151|CDS

ATGAGAGTAGGTAAAGCCGTCGCCACAGTTGCTGCTCATAGGGTATTTCGCTGCGAATCCCTTTCAACCAAAAGTCTAAATACTCCAGCGAACTTGTGCTCTTCTCCTATTTCTGATACCACCATCTCGCCGGAACTTCGAAAGATGCCTTCAGCGGTGGAAGCTAAGATCGCGCCGTCGATGCTATCGTCGGACTTCGCCAATCTGGCATCAGAGGCTGAGCGCATGGTCAGCTTCGGTGCCGATTGGCTTCACATGGA...

Protein

Download Protein FASTA

300 aa · TkA03G007040|TK1151|PROTEIN

MRVGKAVATVAAHRVFRCESLSTKSLNTPANLCSSPISDTTISPELRKMPSAVEAKIAPSMLSSDFANLASEAERMVSFGADWLHMDIMDGYVSDLAKALLLFFPIYQKLADSCHFVQNLTIGAPVIASLRKHTKAYLDCHLMVTNPLDYVDQLSKAGASGFTFHVEVSQDNWQELVTQIKSKGMKPGVALKPGTPIEDVYPLLEGENPVEMVLVMTVEPGFGGQKFIPDMMNKVRTLREKYPELDIEVDGGLGPSTIEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G007040`
TK1151 ID	TkA03G007040
OH-1004 ID	LXL04_006050
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.674 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G007040

Location Chr03:1691704-1694184 (+)

Description Similar to Os09g0505700: Ribulose-phosphate 3-epimerase, cytoplasmic isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0505700`	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006050 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006098 pentose-phosphate shunt Biological Process

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004750 D-ribulose-phosphate 3-epimerase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ago:AGOS_AFL208C

cgr:2890792

dosa:Os09g0505700

sce:YJL121C

spo:2543174

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.519

Rank 1 · TkA03G007040 · TK1151

Mitochondrion0.345

Rank 2 · TkA03G007040 · TK1151

Cytoplasm0.138

Rank 3 · TkA03G007040 · TK1151

Nucleus0.057

Rank 4 · TkA03G007040 · TK1151

Peroxisome0.043

Rank 5 · TkA03G007040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15670Spem131-56 aa

PF00834Ribul_P_3_epim56-96 aa

PF01729QRPTase_C71-91 aa

PF00834Ribul_P_3_epim114-276 aa

PF00215OMPdecase150-191 aa

PF01729QRPTase_C231-275 aa

PF05690ThiG233-293 aa

PF00215OMPdecase238-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G007040	`PF15670`	Spem1	31	56	0.15	12.2
TkA03G007040	`PF00834`	Ribul_P_3_epim	56	96	4.9e-65	219.4
TkA03G007040	`PF01729`	QRPTase_C	71	91	0.22	12.0
TkA03G007040	`PF00834`	Ribul_P_3_epim	114	276	4.9e-65	219.4
TkA03G007040	`PF00215`	OMPdecase	150	191	0.00098	19.8
TkA03G007040	`PF01729`	QRPTase_C	231	275	0.22	12.0
TkA03G007040	`PF05690`	ThiG	233	293	0.19	11.8
TkA03G007040	`PF00215`	OMPdecase	238	285	0.00098	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE42`	Oryza sativa subsp. japonica	sp\|Q9SE42\|RPE1_ORYSJ Ribulose-phosphate 3-epimerase, cytoplasmic isoform	71.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card