TkA02G560740 | RubberDandelionOmics

Gene overview

TkA02G560740

Reference: TK1151 Chr: Chr02 Coordinates: 144823324-144829756 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4940 bp · TkA02G560740|TK1151|cDNA

GAAAAACCCAAAAGAAACTTCGGTTTCCGAGTCAACTCTCTCTCCCTTCACGCCTTATTTGACCGAGTCACGAAATCGGAAGACGCCGATTCTCTCTTTTATGCTTTCTTTCACACACCCCAAATCGTGTGTGCGAGAGAAAGTTGGAGAGAAGGAAAGCGTAAATCTTCATCACAATTTCACTAGCCGAATAGTCTCTTCACAATTCGGCTCATCGATTTCATCTAAAATTTCATTTTGATGGTTGTTTTTAGGGTTTT...

CDS

Download CDS FASTA

4194 bp · TkA02G560740|TK1151|CDS

ATGATGATATCGAGAGGGTTGTTTGGGTGGTCCCCACCACACATACAGCCTTTAACGCCGGTGTCGGAGGTATCGGAACCGCCGGAGTCTCCGTCGCCTTACATGGACACAAGTAACGATGCTTTACCTGTTGAAGCTGAGGAGGAAATGGAAGAGACAGAGGAGATCGAGCCGCCTCCAGCTGCTGTGCCGTTCTCTAAGCTGTTTGTGTGTGCTGATAGGTTTGATTGGGTGCTTATGGTGGTTGGATCGATTGCTGC...

Protein

Download Protein FASTA

1397 aa · TkA02G560740|TK1151|PROTEIN

MMISRGLFGWSPPHIQPLTPVSEVSEPPESPSPYMDTSNDALPVEAEEEMEETEEIEPPPAAVPFSKLFVCADRFDWVLMVVGSIAAAAHGTALVVYLHYFAKIVQLLGHSDEDLDVLFDRFKELTLILVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLTIGFINCWQIAGLTLLTGPFIVAAGGISNIFLHRLAENIQDAYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G560740`
TK1151 ID	TkA02G560740
OH-1004 ID	LXL04_012450
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G560740

Location Chr02:144823324-144829756 (+)

Description Similar to ABCB20: ABC transporter B family member 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39480`	Probable auxin efflux transporter that contributes, together with ABCB20 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At3g55320`	Probable auxin efflux transporter that contributes, together with ABCB6 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At3g28860`	May participate in brassinosteroid export and related signaling.	TWISTED DWARF1, a unique plasma membrane-anchored immunophilin-like protein, interacts with Arabidopsis multidrug resistance-like transporters AtPGP1 and AtPGP19.2003 · DOI: 10.1091/mbc.e02-10-0698 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 An ATP-Binding Cassette Transporter, ABCB19, Regulates Leaf Position and Morphology during Phototropin1-Mediated Blue Light Responses.2020 · DOI: 10.1104/pp.20.00223 Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 ABCB19 transporter: fostering brassinosteroid transport through membrane flexibility.2024 · DOI: 10.1016/j.tplants.2024.06.005 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181 Quantitative analysis of the root posture of Arabidopsis thaliana mutants with wavy roots.2024 · DOI: 10.1017/qpb.2024.12
`At2g36910`	May participate in brassinosteroid export and related signaling.	Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181
`At1g10680`	ABC transporter B family member 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012450 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0048281 inflorescence morphogenesis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0090707 establishment of plant organ orientation Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G39480

ath:AT3G55320

ath:AT5G46540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.441

Rank 1 · TkA02G560740 · TK1151

Lysosome / Vacuole0.242

Rank 2 · TkA02G560740 · TK1151

Endoplasmic reticulum0.146

Rank 3 · TkA02G560740 · TK1151

Cytoplasm0.140

Rank 4 · TkA02G560740 · TK1151

Golgi apparatus0.087

Rank 5 · TkA02G560740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04955HupE_UreJ77-96 aa

PF00664ABC_membrane82-352 aa

PF20990DUF2207_C85-126 aa

PF26768YtrI_N209-226 aa

PF20990DUF2207_C254-338 aa

PF04955HupE_UreJ300-371 aa

PF00005ABC_tran422-567 aa

PF13555AAA_29429-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G560740	`PF04955`	HupE_UreJ	77	96	0.0014	18.8
TkA02G560740	`PF00664`	ABC_membrane	82	352	5.1e-78	263.2
TkA02G560740	`PF20990`	DUF2207_C	85	126	0.28	11.5
TkA02G560740	`PF26768`	YtrI_N	209	226	0.23	12.0
TkA02G560740	`PF20990`	DUF2207_C	254	338	0.28	11.5
TkA02G560740	`PF04955`	HupE_UreJ	300	371	0.0014	18.8
TkA02G560740	`PF00005`	ABC_tran	422	567	2e-51	174.9
TkA02G560740	`PF13555`	AAA_29	429	447	0.00086	19.7
TkA02G560740	`PF06414`	Zeta_toxin	429	471	0.0064	16.7
TkA02G560740	`PF20693`	YobI-ATPase	429	451	0.13	12.5
TkA02G560740	`PF02463`	SMC_N	430	447	1.3e-06	28.7
TkA02G560740	`PF13476`	AAA_23	430	447	0.14	13.5
TkA02G560740	`PF13175`	AAA_15	432	457	0.00099	19.5
TkA02G560740	`PF13304`	AAA_21	434	450	0.00013	22.8
TkA02G560740	`PF02463`	SMC_N	549	598	1.3e-06	28.7
TkA02G560740	`PF13304`	AAA_21	553	594	0.00013	22.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPT1`	Arabidopsis thaliana	sp\|Q8LPT1\|AB6B_ARATH ABC transporter B family member 6	81.900%	Swiss-Prot	High
`Q9M3B9`	Arabidopsis thaliana	sp\|Q9M3B9\|AB20B_ARATH ABC transporter B family member 20	81.100%	Swiss-Prot	High
`Q9LJX0`	Arabidopsis thaliana	sp\|Q9LJX0\|AB19B_ARATH ABC transporter B family member 19	40.300%	Swiss-Prot	Medium
`Q9ZR72`	Arabidopsis thaliana	sp\|Q9ZR72\|AB1B_ARATH ABC transporter B family member 1	40.300%	Swiss-Prot	Medium
`Q9SGY1`	Arabidopsis thaliana	sp\|Q9SGY1\|AB10B_ARATH ABC transporter B family member 10	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card