LXL04_012450 | RubberDandelionOmics

Gene overview

LXL04_012450

Reference: OH-1004 Chr: Chr03 Coordinates: 12380570-12386269 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4197 bp · LXL04_012450|LXL04_012450|OH1004|cDNA

ATGATGATATCGAGAGGGTTGTTTGGGTGGTCCCCACCACACATACAGCCTTTAACGCCGGTGTCGGAGGTATCGGAACCGCCGGAGTCTCCGTCGCCTTACATGGACACAAGTAACGATGCTTTACCTGTTGAAGCTGAGGAGGAAATGGAAGAGACAGAGGAGATCGAGCCGCCTCCAGCTGCTGTGCCGTTCTCTAAGCTGTTTGTGTGTGCTGATAGGTTTGATTGGGTGCTTATGGTGGTTGGATCGATTGCTGC...

CDS

Download CDS FASTA

4197 bp · LXL04_012450|LXL04_012450|OH1004|CDS

ATGATGATATCGAGAGGGTTGTTTGGGTGGTCCCCACCACACATACAGCCTTTAACGCCGGTGTCGGAGGTATCGGAACCGCCGGAGTCTCCGTCGCCTTACATGGACACAAGTAACGATGCTTTACCTGTTGAAGCTGAGGAGGAAATGGAAGAGACAGAGGAGATCGAGCCGCCTCCAGCTGCTGTGCCGTTCTCTAAGCTGTTTGTGTGTGCTGATAGGTTTGATTGGGTGCTTATGGTGGTTGGATCGATTGCTGC...

Protein

Download Protein FASTA

1398 aa · LXL04_012450|LXL04_012450|OH1004|PROTEIN

MMISRGLFGWSPPHIQPLTPVSEVSEPPESPSPYMDTSNDALPVEAEEEMEETEEIEPPPAAVPFSKLFVCADRFDWVLMVVGSIAAAAHGTALVVYLHYFAKIVQLLGHSDEDLDVLFDRFKELTLILVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLTIGFINCWQIAGLTLLTGPFIVAAGGISNIFLHRLAENIQDAYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012450`
TK1151 ID	TkA02G560740
OH-1004 ID	LXL04_012450
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012450

Location Chr03:12380570-12386269 (-)

Description Similar to ABCB20: ABC transporter B family member 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55320`	Probable auxin efflux transporter that contributes, together with ABCB6 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At2g39480`	Probable auxin efflux transporter that contributes, together with ABCB20 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At5g46540`	ABC transporter B family member 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012450 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0048281 inflorescence morphogenesis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0090707 establishment of plant organ orientation Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G39480

ath:AT3G55320

ath:AT5G46540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.433

Rank 1 · LXL04_012450 · OH-1004

Lysosome / Vacuole0.247

Rank 2 · LXL04_012450 · OH-1004

Endoplasmic reticulum0.146

Rank 3 · LXL04_012450 · OH-1004

Cytoplasm0.141

Rank 4 · LXL04_012450 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_012450 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane82-352 aa

PF00005.34ABC_tran422-567 aa

PF00664.29ABC_membrane832-1093 aa

PF00005.34ABC_tran1167-1315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012450	`PF00664.29`	ABC_membrane	82	352	5.1e-78	263.2
LXL04_012450	`PF00005.34`	ABC_tran	422	567	1.4e-54	185.1
LXL04_012450	`PF00664.29`	ABC_membrane	832	1093	5.1e-78	263.2
LXL04_012450	`PF00005.34`	ABC_tran	1167	1315	1.4e-54	185.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3B9`	Arabidopsis thaliana	ABC transporter B family member 20	81.285%	Swiss-Prot	strong database homology
`Q8LPT1`	Arabidopsis thaliana	ABC transporter B family member 6	82.249%	Swiss-Prot	strong database homology
`Q9FHF1`	Arabidopsis thaliana	ABC transporter B family member 7	35.450%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card