TkA02G523960 | RubberDandelionOmics

Gene overview

TkA02G523960

Reference: TK1151 Chr: Chr02 Coordinates: 135105366-135111740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4631 bp · TkA02G523960|TK1151|cDNA

ATAAAAATCCATCCGTGCTGATCTCATCACGTGTTCATCACCGATTAATCCATAAACTTGAGATTTTTTTAGAAAGAAAGATAAAGATTCGAAATTCTTTAACATGCTTCTTCTATACTTCCCGGGAACCGCCTCTCAGATGAATATCCCAAATATATAATAAAGACACCGACCTCCGATCCACATCAGAATCGAAAACTCATACAAGAGTTTCAAAGAAACAATCAATCTCGCACTCATAAAAGCTCCCACTTTTTTTC...

CDS

Download CDS FASTA

2388 bp · TkA02G523960|TK1151|CDS

ATGGGATCTTTGACGAGCGAAGAGGAACTAGAGGTGATCGGAGAAGTGTCAAAGGATGCTATTTTGTATGTTAATGGAGTCCGTAAAGTGCTCCCTGATGGTCTGGCTCACTTAACTCTACTCGAGTATCTCAGAGATATAGGTTTGACAGGAACAAAACTAGGATGTGGGGAAGGAGGTTGTGGGGCATGTACTGTAATGGTTTCATACTTGGATCCAAATTCAAAAAAATGCGTCCACCAGGCAATCAATGCTTGCTT...

Protein

Download Protein FASTA

795 aa · TkA02G523960|TK1151|PROTEIN

MGSLTSEEELEVIGEVSKDAILYVNGVRKVLPDGLAHLTLLEYLRDIGLTGTKLGCGEGGCGACTVMVSYLDPNSKKCVHQAINACLAPLYSVEGMQVITVEGLGNRKFGLHPVQETLASNHGSQCGFCTPGFIMSMYALLRSSKTPPTEEQIEESLAGNLCRCTGYRPILDAFRVFSKTNDLLYTNNSISISSLKDGDFVCPSTGKPCSCGSKTVQKDNICHDYKPVSYNEIDGSSYTNKEIIFPPQLLMRKPSYLSLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G523960`
TK1151 ID	TkA02G523960
OH-1004 ID	LXL04_013002
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 97.862 / OH-1004 43.546 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G523960

Location Chr02:135105366-135111740 (+)

Description Similar to XDH1: Xanthine dehydrogenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34890`	Key enzyme involved in purine catabolism.	Tandem orientation of duplicated xanthine dehydrogenase genes from Arabidopsis thaliana: differential gene expression and enzyme activities.2004 · DOI: 10.1074/jbc.m312929200 The plant Mo-hydroxylases aldehyde oxidase and xanthine dehydrogenase have distinct reactive oxygen species signatures and are induced by drought and abscisic acid.2005 · DOI: 10.1111/j.1365-313x.2005.02422.x The RNAi-mediated silencing of xanthine dehydrogenase impairs growth and fertility and accelerates leaf senescence in transgenic Arabidopsis plants.2007 · DOI: 10.1093/pcp/pcm119 A critical role for ureides in dark and senescence-induced purine remobilization is unmasked in the Atxdh1 Arabidopsis mutant.2008 · DOI: 10.1111/j.1365-313x.2008.03440.x Xanthine dehydrogenase AtXDH1 from Arabidopsis thaliana is a potent producer of superoxide anions via its NADH oxidase activity.2010 · DOI: 10.1007/s11103-009-9570-2
`At4g34900`	Key enzyme involved in purine catabolism.	The RNAi-mediated silencing of xanthine dehydrogenase impairs growth and fertility and accelerates leaf senescence in transgenic Arabidopsis plants.2007 · DOI: 10.1093/pcp/pcm119

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0429800`	Key enzyme involved in purine catabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013002 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006145 purine nucleobase catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0042554 superoxide anion generation Biological Process

GO:0046110 xanthine metabolic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004854 xanthine dehydrogenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT4G34890

ath:AT4G34900

dosa:Os03g0429800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658

Rank 1 · TkA02G523960 · TK1151

Nucleus0.226

Rank 2 · TkA02G523960 · TK1151

Peroxisome0.111

Rank 3 · TkA02G523960 · TK1151

Mitochondrion0.109

Rank 4 · TkA02G523960 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA02G523960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00111Fer237-88 aa

PF10418DHODB_Fe-S_bind54-70 aa

PF01799Fer2_2100-174 aa

PF00111Fer2122-164 aa

PF00941FAD_binding_5265-442 aa

PF03450CO_deh_flav_C411-421 aa

PF03450CO_deh_flav_C451-556 aa

PF01315Ald_Xan_dh_C615-722 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G523960	`PF00111`	Fer2	37	88	1.2e-07	32.3
TkA02G523960	`PF10418`	DHODB_Fe-S_bind	54	70	0.5	10.8
TkA02G523960	`PF01799`	Fer2_2	100	174	1.1e-32	112.7
TkA02G523960	`PF00111`	Fer2	122	164	1.2e-07	32.3
TkA02G523960	`PF00941`	FAD_binding_5	265	442	1.1e-47	162.7
TkA02G523960	`PF03450`	CO_deh_flav_C	411	421	1.7e-28	99.5
TkA02G523960	`PF03450`	CO_deh_flav_C	451	556	1.7e-28	99.5
TkA02G523960	`PF01315`	Ald_Xan_dh_C	615	722	1e-30	107.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUQ8`	Arabidopsis thaliana	sp\|Q8GUQ8\|XDH1_ARATH Xanthine dehydrogenase 1	66.400%	Swiss-Prot	High
`F4JLI5`	Arabidopsis thaliana	sp\|F4JLI5\|XDH2_ARATH Xanthine dehydrogenase 2	66.200%	Swiss-Prot	High
`Q6AUV1`	Oryza sativa subsp. japonica	sp\|Q6AUV1\|XDH_ORYSJ Xanthine dehydrogenase	64.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card