LXL04_013002 | RubberDandelionOmics

Gene overview

LXL04_013002

Reference: OH-1004 Chr: Chr03 Coordinates: 22152837-22162989 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5418 bp · LXL04_013002|LXL04_013002|OH1004|cDNA

ATGGGATCTTTGACGAGCGAAGAGGAACTAGAGGTGATCGGAGAAGTGTCAAAGGATGCTATTTTGTATGTTAATGGAGTCCGTAAAGTGCTCCCTGATGGTCTGGCTCACTTAACTCTACTCGAGTATCTCAGAGATATAGGTTTGACAGGAACAAAACTAGGATGTGGGGAAGGAGGTTGTGGGGCATGTACTGTAATGGTTTCATACTTGGATCCAAATTCAAAAAAATGCGTCCACCAGGCAATGAATGCTTGCTT...

CDS

Download CDS FASTA

5418 bp · LXL04_013002|LXL04_013002|OH1004|CDS

ATGGGATCTTTGACGAGCGAAGAGGAACTAGAGGTGATCGGAGAAGTGTCAAAGGATGCTATTTTGTATGTTAATGGAGTCCGTAAAGTGCTCCCTGATGGTCTGGCTCACTTAACTCTACTCGAGTATCTCAGAGATATAGGTTTGACAGGAACAAAACTAGGATGTGGGGAAGGAGGTTGTGGGGCATGTACTGTAATGGTTTCATACTTGGATCCAAATTCAAAAAAATGCGTCCACCAGGCAATGAATGCTTGCTT...

Protein

Download Protein FASTA

1805 aa · LXL04_013002|LXL04_013002|OH1004|PROTEIN

MGSLTSEEELEVIGEVSKDAILYVNGVRKVLPDGLAHLTLLEYLRDIGLTGTKLGCGEGGCGACTVMVSYLDPNSKKCVHQAMNACLAPLYSVEGMQVITVEGLGNRKFGLHPVQETLARNHGSQCGFCTPGFIMSMYALLRSSKTPPTEEQIEESLAGNLCRCTGYRPILDAFRVFSKTNDLLYTNNSVSVSSLKDGDFVCPSTGKPCSCGSKTVQKDNICHDYKPVSYNEIDGSSYTNKEIIFPPQLLMRKPSYLSLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013002`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013002

Location Chr03:22152837-22162989 (-)

Description Similar to XDH1: Xanthine dehydrogenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34890`	Key enzyme involved in purine catabolism.	Tandem orientation of duplicated xanthine dehydrogenase genes from Arabidopsis thaliana: differential gene expression and enzyme activities.2004 · DOI: 10.1074/jbc.m312929200 The plant Mo-hydroxylases aldehyde oxidase and xanthine dehydrogenase have distinct reactive oxygen species signatures and are induced by drought and abscisic acid.2005 · DOI: 10.1111/j.1365-313x.2005.02422.x The RNAi-mediated silencing of xanthine dehydrogenase impairs growth and fertility and accelerates leaf senescence in transgenic Arabidopsis plants.2007 · DOI: 10.1093/pcp/pcm119 A critical role for ureides in dark and senescence-induced purine remobilization is unmasked in the Atxdh1 Arabidopsis mutant.2008 · DOI: 10.1111/j.1365-313x.2008.03440.x Xanthine dehydrogenase AtXDH1 from Arabidopsis thaliana is a potent producer of superoxide anions via its NADH oxidase activity.2010 · DOI: 10.1007/s11103-009-9570-2
`At4g34900`	Key enzyme involved in purine catabolism.	The RNAi-mediated silencing of xanthine dehydrogenase impairs growth and fertility and accelerates leaf senescence in transgenic Arabidopsis plants.2007 · DOI: 10.1093/pcp/pcm119

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0429800`	Key enzyme involved in purine catabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013002 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006145 purine nucleobase catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0042554 superoxide anion generation Biological Process

GO:0046110 xanthine metabolic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004854 xanthine dehydrogenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT4G34890

ath:AT4G34900

dosa:Os03g0429800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.594

Rank 1 · LXL04_013002 · OH-1004

Nucleus0.185

Rank 2 · LXL04_013002 · OH-1004

Mitochondrion0.141

Rank 3 · LXL04_013002 · OH-1004

Peroxisome0.099

Rank 4 · LXL04_013002 · OH-1004

Endoplasmic reticulum0.097

Rank 5 · LXL04_013002 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00111.33Fer237-88 aa

PF01799.26Fer2_2100-174 aa

PF00941.28FAD_binding_5265-442 aa

PF03450.23CO_deh_flav_C451-556 aa

PF01315.28Ald_Xan_dh_C615-722 aa

PF02738.24MoCoBD_1744-980 aa

PF20256.4MoCoBD_21005-1277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013002	`PF00111.33`	Fer2	37	88	3.4e-07	30.8
LXL04_013002	`PF01799.26`	Fer2_2	100	174	3.6e-32	111.0
LXL04_013002	`PF00941.28`	FAD_binding_5	265	442	4e-47	160.9
LXL04_013002	`PF03450.23`	CO_deh_flav_C	451	556	7.8e-28	97.3
LXL04_013002	`PF01315.28`	Ald_Xan_dh_C	615	722	3.2e-31	108.6
LXL04_013002	`PF02738.24`	MoCoBD_1	744	980	7.2e-85	284.7
LXL04_013002	`PF20256.4`	MoCoBD_2	1005	1277	9.5e-90	301.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUQ8`	Arabidopsis thaliana	Xanthine dehydrogenase 1	73.080%	Swiss-Prot	strong database homology
`F4JLI5`	Arabidopsis thaliana	Xanthine dehydrogenase 2	72.053%	Swiss-Prot	strong database homology
`Q6AUV1`	Oryza sativa subsp. japonica	Xanthine dehydrogenase	69.259%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card