TkA02G511430 | RubberDandelionOmics

Gene overview

TkA02G511430

Reference: TK1151 Chr: Chr02 Coordinates: 131304290-131305546 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · TkA02G511430|TK1151|cDNA

TTGCTTTTAGTTTCAACGCGTATAACCCTTCCTCTCTCGTCTCCTTATTTCCTCCGCATCTCCTTTCAAATCCCTAATTCACTTTTCCGATCTGATTTTTCTCTCGATCTCTTGACAATGGATGCTTTGGATTCAGTCTTCGAGCCATTGAGAGAGTTCTCAAAGGATAGCTACCGTCTAGTCAAGAGATGCCACAAGCCTGATCGTAAAGAATTCTCGAAGGTTGCAGTTCGTACAGCGATTGGTTTCGTGGTGATGGG...

CDS

Download CDS FASTA

327 bp · TkA02G511430|TK1151|CDS

TTGCTTTTAGTTTCAACGCGTATAACCCTTCCTCTCTCGTCTCCTTATTTCCTCCGCATCTCCTTTCAAATCCCTAATTCACTTTTCCGATCTGATTTTTCTCTCGATCTCTTGACAATGGATGCTTTGGATTCAGTCTTCGAGCCATTGAGAGAGTTCTCAAAGGATAGCTACCGTCTAGTCAAGAGATGCCACAAGCCTGATCGTAAAGAATTCTCGAAGGTTGCAGTTCGTACAGCGATTGGTTTCGTGGTGATGGG...

Protein

Download Protein FASTA

108 aa · TkA02G511430|TK1151|PROTEIN

LLLVSTRITLPLSSPYFLRISFQIPNSLFRSDFSLDLLTMDALDSVFEPLREFSKDSYRLVKRCHKPDRKEFSKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G511430`
TK1151 ID	TkA02G511430
OH-1004 ID	LXL04_013212
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 71.296 / OH-1004 56.618 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G511430

Location Chr02:131304290-131305546 (-)

Description Similar to SEC61G2: Protein transport protein Sec61 subunit gamma-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24920`	Necessary for protein translocation in the endoplasmic reticulum.	No verified direct reference in this release
`At5g50460`	Necessary for protein translocation in the endoplasmic reticulum.	No verified direct reference in this release
`At3g48570`	Necessary for protein translocation in the endoplasmic reticulum.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0178400`	Necessary for protein translocation in the endoplasmic reticulum.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013212 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0030728 ovulation Biological Process

GO:0031204 post-translational protein targeting to membrane, translocation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005784 Sec61 translocon complex Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0071261 Ssh1 translocon complex Cellular Component

GO:0008320 protein transmembrane transporter activity Molecular Function

GO:0015450 protein-transporting ATPase activity Molecular Function

KEGG gene cross-reference

ath:AT3G48570

ath:AT4G24920

ath:AT5G50460

cel:CELE_F32D8.6

dosa:Os02g0178400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.656

Rank 1 · TkA02G511430 · TK1151

Golgi apparatus0.185

Rank 2 · TkA02G511430 · TK1151

Nucleus0.113

Rank 3 · TkA02G511430 · TK1151

Cytoplasm0.085

Rank 4 · TkA02G511430 · TK1151

Cell membrane0.056

Rank 5 · TkA02G511430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00584SecE52-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G511430	`PF00584`	SecE	52	104	6.4e-14	52.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DI74`	Arabidopsis thaliana	sp\|P0DI74\|S61G1_ARATH Protein transport protein Sec61 subunit gamma-1	88.200%	Swiss-Prot	Medium
`P0DI75`	Arabidopsis thaliana	sp\|P0DI75\|S61G2_ARATH Protein transport protein Sec61 subunit gamma-2	88.200%	Swiss-Prot	Medium
`Q9SMP2`	Arabidopsis thaliana	sp\|Q9SMP2\|S61G3_ARATH Protein transport protein Sec61 subunit gamma-3	82.400%	Swiss-Prot	Medium
`P38385`	Oryza sativa subsp. japonica	sp\|P38385\|SC61G_ORYSJ Protein transport protein Sec61 subunit gamma	89.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card