TkA02G494420 | RubberDandelionOmics

Gene overview

TkA02G494420

Reference: TK1151 Chr: Chr02 Coordinates: 126552899-126564405 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4077 bp · TkA02G494420|TK1151|cDNA

AGAAGCTAACGATTCCTGGAACATCGACACAATTTCTTTTTCCCTCTTCTTATTCGTTGCAAACTAGGGTTCCTTCCCCATCATCGAATTCCTACCCGATGGTTTACGAATTAGGTCACGCACGCGACCAATTCGAGAACAACAACAACGTTGCTATTCAGATAGAAGGGGGTGTGGCGGGTAATTTGCACAAGAAGCGGCGTTCCGGCGTCAATAATGTTAATAAGTTTATCGGTAACGTTGCCAAAAACTATATGGAG...

CDS

Download CDS FASTA

3492 bp · TkA02G494420|TK1151|CDS

ATGGTTTACGAATTAGGTCACGCACGCGACCAATTCGAGAACAACAACAACGTTGCTATTCAGATAGAAGGGGGTGTGGCGGGTAATTTGCACAAGAAGCGGCGTTCCGGCGTCAATAATGTTAATAAGTTTATCGGTAACGTTGCCAAAAACTATATGGAGACAACTGTGGGAGAGAATTGGCCATCCGACCTTATCAATCACTTGAACAACCGATTCCCCACTTCCATCGATTCTATAAAGAACTTTATTCAATCAAA...

Protein

Download Protein FASTA

1163 aa · TkA02G494420|TK1151|PROTEIN

MVYELGHARDQFENNNNVAIQIEGGVAGNLHKKRRSGVNNVNKFIGNVAKNYMETTVGENWPSDLINHLNNRFPTSIDSIKNFIQSNGNLHDIVSNSIPSPHSSLPDLLVSPVLDTSTSTYPENYMNLGYNHYNPASIYNPEFCRGSSFNGDCGGMKLISPLGVKQTEHLDLITSPEQVSSITACSYGDMISDTEAFDSRAFYQLRTQTQPMQTQQQQPQQPQHVILESSNQISSLQVISSYIMYKDMPADLRKEVPFQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G494420`
TK1151 ID	TkA02G494420
OH-1004 ID	LXL04_013473
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 61.869 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G494420

Location Chr02:126552899-126564405 (-)

Description Similar to HAC1: Histone acetyltransferase HAC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16710`	Acetyltransferase enzyme.	No verified direct reference in this release
`At1g79000`	Acetyltransferase enzyme.	No verified direct reference in this release
`At1g55970`	Acetyltransferase enzyme.	No verified direct reference in this release
`At3g12980`	Acetyltransferase enzyme.	No verified direct reference in this release
`At5g16020`	Required for micropylar pollen tube guidance.	GEX3, expressed in the male gametophyte and in the egg cell of Arabidopsis thaliana, is essential for micropylar pollen tube guidance and plays a role during early embryogenesis.2008 · DOI: 10.1093/mp/ssn015

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0137500`	Acetyltransferase enzyme.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013473 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006473 protein acetylation Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0000123 histone acetyltransferase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003713 transcription coactivator activity Molecular Function

KEGG gene cross-reference

ath:AT1G16710

ath:AT1G79000

ath:AT3G12980

dosa:Os02g0137500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.725

Rank 1 · TkA02G494420 · TK1151

Cytoplasm0.300

Rank 2 · TkA02G494420 · TK1151

Cell membrane0.043

Rank 3 · TkA02G494420 · TK1151

Mitochondrion0.037

Rank 4 · TkA02G494420 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA02G494420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00538Linker_histone66-92 aa

PF00538Linker_histone234-244 aa

PF02135zf-TAZ261-295 aa

PF00628PHD452-474 aa

PF00628PHD495-504 aa

PF00628PHD527-567 aa

PF20826PHD_5531-564 aa

PF00569ZZ535-540 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G494420	`PF00538`	Linker_histone	66	92	0.35	11.8
TkA02G494420	`PF00538`	Linker_histone	234	244	0.35	11.8
TkA02G494420	`PF02135`	zf-TAZ	261	295	1e-10	42.6
TkA02G494420	`PF00628`	PHD	452	474	9.5e-05	23.1
TkA02G494420	`PF00628`	PHD	495	504	9.5e-05	23.1
TkA02G494420	`PF00628`	PHD	527	567	9.5e-05	23.1
TkA02G494420	`PF20826`	PHD_5	531	564	0.036	14.8
TkA02G494420	`PF00569`	ZZ	535	540	0.0092	16.5
TkA02G494420	`PF00569`	ZZ	561	569	0.0092	16.5
TkA02G494420	`PF29847`	KAT3	632	847	1e-73	249.2
TkA02G494420	`PF00538`	Linker_histone	777	799	0.35	11.8
TkA02G494420	`PF00569`	ZZ	897	938	0.0092	16.5
TkA02G494420	`PF00628`	PHD	911	920	9.5e-05	23.1
TkA02G494420	`PF02135`	zf-TAZ	916	940	1e-10	42.6
TkA02G494420	`PF02135`	zf-TAZ	1016	1051	1e-10	42.6
TkA02G494420	`PF00569`	ZZ	1016	1051	0.0092	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWQ5`	Arabidopsis thaliana	sp\|Q9FWQ5\|HAC12_ARATH Histone acetyltransferase HAC12	50.300%	Swiss-Prot	High
`Q9C5X9`	Arabidopsis thaliana	sp\|Q9C5X9\|HAC1_ARATH Histone acetyltransferase HAC1	48.500%	Swiss-Prot	Medium
`Q9LG11`	Arabidopsis thaliana	sp\|Q9LG11\|HAC4_ARATH Histone acetyltransferase HAC4	46.700%	Swiss-Prot	Medium
`Q9LE42`	Arabidopsis thaliana	sp\|Q9LE42\|HAC5_ARATH Histone acetyltransferase HAC5	47.000%	Swiss-Prot	Medium
`Q9LFS2`	Arabidopsis thaliana	sp\|Q9LFS2\|GEX3_ARATH Protein GAMETE EXPRESSED 3	42.600%	Swiss-Prot	Medium
`Q6YXY2`	Oryza sativa subsp. japonica	sp\|Q6YXY2\|HACL1_ORYSJ Probable histone acetyltransferase HAC-like 1	47.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card