LXL04_013473 | RubberDandelionOmics

Gene overview

LXL04_013473

Reference: OH-1004 Chr: Chr03 Coordinates: 30133456-30144195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5596 bp · LXL04_013473|LXL04_013473|OH1004|cDNA

ATGGTTTACGAATTAGGTCACGCACGCGTCCAATTGGAGAACAACAACGTTGCTATTCAGATAGAAGGGGATGTGGCGGGTAATTTGCACAAGAAGCGGCGTTCCGGCGTCAATAATGTTAATAAGTTTATCGTTTCTGCTACCTCAGAGTCTGGTTTTCTTAATCTCCCGACATATCAACACTTTGAATCAGAACGAGATACACAAGCAAAATCCGCACCCACGCTATCAAATCCTTTGATTGGTGACAATGGGAAGAT...

CDS

Download CDS FASTA

5589 bp · LXL04_013473|LXL04_013473|OH1004|CDS

ATGGTTTACGAATTAGGTCACGCACGCGTCCAATTGGAGAACAACAACGTTGCTATTCAGATAGAAGGGGATGTGGCGGGTAATTTGCACAAGAAGCGGCGTTCCGGCGTCAATAATGTTAATAAGTTTATCGTTTCTGCTACCTCAGAGTCTGGTTTTCTTAATCTCCCGACATATCAACACTTTGAATCAGAACGAGATACACAAGCAAAATCCGCACCCACGCTATCAAATCCTTTGATTGGTGACAATGGGAAGAT...

Protein

Download Protein FASTA

1862 aa · LXL04_013473|LXL04_013473|OH1004|PROTEIN

MVYELGHARVQLENNNVAIQIEGDVAGNLHKKRRSGVNNVNKFIVSATSESGFLNLPTYQHFESERDTQAKSAPTLSNPLIGDNGKIYICSEKKLLIFHNKGSISNTIPLKYTCNDITPVFGASRRLYLVAGNRVLRINLQTRESTTEVFLGPETGVHGMNEILGLSVSISSSCVLVNIKRKGLFSYNYDGKLRWSTPPVITRRGYTQGCRKNITDCYFVSPPVIDYCDSNVYMSNNQGEIYAVSIRSPQFKWIQDLSSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013473`
TK1151 ID	TkA02G494420
OH-1004 ID	LXL04_013473
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 61.869 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013473

Location Chr03:30133456-30144195 (+)

Description Similar to HAC1: Histone acetyltransferase HAC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79000`	Acetyltransferase enzyme.	No verified direct reference in this release
`At1g16710`	Acetyltransferase enzyme.	No verified direct reference in this release
`At3g12980`	Acetyltransferase enzyme.	No verified direct reference in this release
`At1g55970`	Acetyltransferase enzyme.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0137500`	Acetyltransferase enzyme.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013473 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006473 protein acetylation Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0000123 histone acetyltransferase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003713 transcription coactivator activity Molecular Function

KEGG gene cross-reference

ath:AT1G16710

ath:AT1G79000

ath:AT3G12980

dosa:Os02g0137500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.396

Rank 1 · LXL04_013473 · OH-1004

Cytoplasm0.334

Rank 2 · LXL04_013473 · OH-1004

Cell membrane0.180

Rank 3 · LXL04_013473 · OH-1004

Endoplasmic reticulum0.119

Rank 4 · LXL04_013473 · OH-1004

Golgi apparatus0.081

Rank 5 · LXL04_013473 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13360.14PQQ_283-298 aa

PF28764.1GEX3_C472-573 aa

PF29847.1KAT31342-1547 aa

PF02135.22zf-TAZ1782-1852 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013473	`PF13360.14`	PQQ_2	83	298	2.5e-07	31.3
LXL04_013473	`PF28764.1`	GEX3_C	472	573	6.8e-39	133.2
LXL04_013473	`PF29847.1`	KAT3	1342	1547	4e-69	234.1
LXL04_013473	`PF02135.22`	zf-TAZ	1782	1852	1.8e-10	41.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5X9`	Arabidopsis thaliana	Histone acetyltransferase HAC1	47.864%	Swiss-Prot	weak database homology
`Q9FWQ5`	Arabidopsis thaliana	Histone acetyltransferase HAC12	49.174%	Swiss-Prot	weak database homology
`Q9LE42`	Arabidopsis thaliana	Histone acetyltransferase HAC5	45.822%	Swiss-Prot	weak database homology
`Q9LG11`	Arabidopsis thaliana	Histone acetyltransferase HAC4	45.328%	Swiss-Prot	weak database homology
`Q6YXY2`	Oryza sativa subsp. japonica	Probable histone acetyltransferase HAC-like 1	40.868%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card