TkA02G412790 | RubberDandelionOmics

Gene overview

TkA02G412790

Reference: TK1151 Chr: Chr02 Coordinates: 104984651-104988251 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2041 bp · TkA02G412790|TK1151|cDNA

AAAGCATAAAATATACAAAATCCCACAAACATTTCTCCATCATAATCATAAGGTTAAATAAGTTTTACGATATAAATTTCACCAAACCCTCCTTCCATTAAAAAGCTTACTTCATATCCCATTTCTGCAAATTCTGCCATGTCACTGTCTTTTGTAAGGATTTAGTCGGAAAAAAAGTTAGAGAAGGTTGCACACGGTGGCGGAAGTGGTGGTTGGAAAGTGGCAATGACGACATCTTCTTCTACAGAAAACAAATTCTC...

CDS

Download CDS FASTA

1476 bp · TkA02G412790|TK1151|CDS

ATGACGACATCTTCTTCTACAGAAAACAAATTCTCAGTTCCAATTAAAGAGAAAACTATTCAGTATTATCTTTACCCGCCTCCCATTGGCCAATTTGAAGATGTTATGGCCAGTTATAAACTCTTCATGGATACACTTGGAAAATTCCATGCTGCTATGGGGACCAAATTCAAGATTCCGATTGTTGGCGGCAAGGATCTGGACTTGCATCGCCTATTTATGGAAGTCACTTCTCGTGGTGGCATTAAAAGGGTTCTTGA...

Protein

Download Protein FASTA

491 aa · TkA02G412790|TK1151|PROTEIN

MTTSSSTENKFSVPIKEKTIQYYLYPPPIGQFEDVMASYKLFMDTLGKFHAAMGTKFKIPIVGGKDLDLHRLFMEVTSRGGIKRVLEDKKWREVTNVFNFPPSATNASFILRKYYMSLLHHFEQVYYFKAKAWTPVPTDTWQSTKSTLTSMTEMNKVVLPLTENQVTLGKRQRTETEEASPESSIGFPVTGTIDGKFESGYLCTVGIGGEQLQGVLYQTLCTHYAKVTQDANATMVRQRRRRRKKSEMKKRDPAHPKPNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G412790`
TK1151 ID	TkA02G412790
OH-1004 ID	LXL04_014562
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 94.297 / OH-1004 87.856 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G412790

Location Chr02:104984651-104988251 (-)

Description Similar to HMGB15: High mobility group B protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04880`	Binds preferentially DNA with A/T-rich content.	No verified direct reference in this release
`At1g76110`	Binds preferentially DNA with A/T-rich content.	NUCLEAR FUSION DEFECTIVE1 encodes the Arabidopsis RPL21M protein and is required for karyogamy during female gametophyte development and fertilization.2006 · DOI: 10.1104/pp.106.079319 A novel family of plant DNA-binding proteins containing both HMG-box and AT-rich interaction domains.2008 · DOI: 10.1021/bi801772k
`At3g13350`	Binds preferentially DNA with A/T-rich content.	No verified direct reference in this release
`At1g55650`	Binds preferentially DNA with A/T-rich content.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0006337 nucleosome disassembly Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

KEGG gene cross-reference

ath:AT1G04880

ath:AT1G55650

ath:AT1G76110

ath:AT3G13350

mmu:77044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA02G412790 · TK1151

Cytoplasm0.079

Rank 2 · TkA02G412790 · TK1151

Cell membrane0.020

Rank 3 · TkA02G412790 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA02G412790 · TK1151

Plastid0.008

Rank 5 · TkA02G412790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01388ARID39-123 aa

PF14887HMG_box_582-106 aa

PF27637MNM1_beta189-218 aa

PF14887HMG_box_5238-250 aa

PF09011HMG_box_2253-322 aa

PF00505HMG_box256-323 aa

PF14887HMG_box_5290-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G412790	`PF01388`	ARID	39	123	3.2e-23	82.7
TkA02G412790	`PF14887`	HMG_box_5	82	106	0.007	17.0
TkA02G412790	`PF27637`	MNM1_beta	189	218	2.3e-08	34.2
TkA02G412790	`PF14887`	HMG_box_5	238	250	0.007	17.0
TkA02G412790	`PF09011`	HMG_box_2	253	322	4.1e-11	44.1
TkA02G412790	`PF00505`	HMG_box	256	323	1.6e-15	58.0
TkA02G412790	`PF14887`	HMG_box_5	290	323	0.007	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAT6`	Arabidopsis thaliana	sp\|Q9MAT6\|HMG15_ARATH High mobility group B protein 15	50.000%	Swiss-Prot	High
`Q9SGS2`	Arabidopsis thaliana	sp\|Q9SGS2\|HMGB9_ARATH High mobility group B protein 9	41.900%	Swiss-Prot	Medium
`Q9LTT3`	Arabidopsis thaliana	sp\|Q9LTT3\|HMG10_ARATH High mobility group B protein 10	42.200%	Swiss-Prot	Medium
`Q9LG02`	Arabidopsis thaliana	sp\|Q9LG02\|HMG11_ARATH Putative high mobility group B protein 11	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card