TkA02G397810 | RubberDandelionOmics

Gene overview

TkA02G397810

Reference: TK1151 Chr: Chr02 Coordinates: 101069311-101070344 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · TkA02G397810|TK1151|cDNA

ATGAAAAGTACAGTTTCGTCCTTAAAGGACCAATGTTACAGTTTACTAGATGAGAAAAAAGTTGAAAAGATTCTAAGAAGCAGAAAATTTGGTTTCTCAAGGGTAAGATTTTGTCCAAAACCAAATGGAATAAGACCATTAGCCAATCTTAAATCATCATCAAGATTACCAAAAACCTATAAATACTTCAAAGCTGTAAATACTGTTCTTAGAGATCTTCATGCAGCCCTAAAAGACATTCAACTCAAAACCCCAGAAAA...

CDS

Download CDS FASTA

966 bp · TkA02G397810|TK1151|CDS

ATGAAAAGTACAGTTTCGTCCTTAAAGGACCAATGTTACAGTTTACTAGATGAGAAAAAAGTTGAAAAGATTCTAAGAAGCAGAAAATTTGGTTTCTCAAGGGTAAGATTTTGTCCAAAACCAAATGGAATAAGACCATTAGCCAATCTTAAATCATCATCAAGATTACCAAAAACCTATAAATACTTCAAAGCTGTAAATACTGTTCTTAGAGATCTTCATGCAGCCCTAAAAGACATTCAACTCAAAACCCCAGAAAA...

Protein

Download Protein FASTA

321 aa · TkA02G397810|TK1151|PROTEIN

MKSTVSSLKDQCYSLLDEKKVEKILRSRKFGFSRVRFCPKPNGIRPLANLKSSSRLPKTYKYFKAVNTVLRDLHAALKDIQLKTPEKLGSSVFSYNDVHKKLRDFLTRVKRGLDGSTCVYMVVADVAKAYDSIDQDKLIHVMEDVITDDHLLHETQNVSILKRNVQISQSVSLSRQFQSYYRSSSSHSIFIDQGIRRIARKEDLLTILRQHVKSNVLHIDNKFYLQNVGIPQGSILSSLLCSFYYGHMENKRLVPFIDKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G397810`
TK1151 ID	TkA02G397810
OH-1004 ID	LXL04_014777
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 30.747 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G397810

Location Chr02:101069311-101070344 (-)

Description Similar to TERT: Telomerase reverse transcriptase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16850`	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes.	Molecular cloning and characterization of AtTERT, a telomerase reverse transcriptase homolog in Arabidopsis thaliana.1999 · DOI: 10.1016/s0014-5793(99)01083-2 Disruption of the telomerase catalytic subunit gene from Arabidopsis inactivates telomerase and leads to a slow loss of telomeric DNA.1999 · DOI: 10.1073/pnas.96.26.14813 Rearrangements of ribosomal DNA clusters in late generation telomerase-deficient Arabidopsis.2003 · DOI: 10.1007/s00412-003-0251-7

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0293100`	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014777 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010449 root meristem growth Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0050000 chromosome localization Biological Process

GO:0000333 telomerase catalytic core complex Cellular Component

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005697 telomerase holoenzyme complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT5G16850

bta:518884

cfa:403412

dosa:Os12g0293100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.846

Rank 1 · TkA02G397810 · TK1151

Cytoplasm0.159

Rank 2 · TkA02G397810 · TK1151

Mitochondrion0.026

Rank 3 · TkA02G397810 · TK1151

Cell membrane0.023

Rank 4 · TkA02G397810 · TK1151

Extracellular0.019

Rank 5 · TkA02G397810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_160-310 aa

PF27577ESF2_C221-228 aa

PF27577ESF2_C280-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G397810	`PF00078`	RVT_1	60	310	2.9e-12	47.6
TkA02G397810	`PF27577`	ESF2_C	221	228	0.04	14.1
TkA02G397810	`PF27577`	ESF2_C	280	297	0.04	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPU7`	Arabidopsis thaliana	sp\|Q9SPU7\|TERT_ARATH Telomerase reverse transcriptase	39.000%	Swiss-Prot	Medium
`Q8LKW0`	Oryza sativa subsp. japonica	sp\|Q8LKW0\|TERT_ORYSJ Telomerase reverse transcriptase	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card