TkA02G395550 | RubberDandelionOmics

Gene overview

TkA02G395550

Reference: TK1151 Chr: Chr02 Coordinates: 100447133-100450189 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1262 bp · TkA02G395550|TK1151|cDNA

CTAACTCTAAGTAATCTCATTGTGTTTATCTTCATAAAATCACAATTTTACAAAGTCAACGCTATCAAAATAACCATGTCTTCTTCCGGTGTTAACCTAGAAAGTTTTCTAATTCCGCTGAAAGAGATCAACTTGGCAACTCAAGACTTCAACCCCGAAACACGCATCGGAGATGGTGGATTCGGTATGGTCCACAAAGGACAACTCTCAGAACCATGGCAAAACCGCACAGTTGCCATCAAACGCCTCGATCTCAAAGG...

CDS

Download CDS FASTA

1029 bp · TkA02G395550|TK1151|CDS

ATGTCTTCTTCCGGTGTTAACCTAGAAAGTTTTCTAATTCCGCTGAAAGAGATCAACTTGGCAACTCAAGACTTCAACCCCGAAACACGCATCGGAGATGGTGGATTCGGTATGGTCCACAAAGGACAACTCTCAGAACCATGGCAAAACCGCACAGTTGCCATCAAACGCCTCGATCTCAAAGGTTACCAAGGAAAGGACGAGTTCCTTACTGAGCTGAAGTTGATTTCCAAGTTTCAACACGAAAACATCATCCGTTT...

Protein

Download Protein FASTA

342 aa · TkA02G395550|TK1151|PROTEIN

MSSSGVNLESFLIPLKEINLATQDFNPETRIGDGGFGMVHKGQLSEPWQNRTVAIKRLDLKGYQGKDEFLTELKLISKFQHENIIRFVGYCDQGEEMILVYEYASNGSLDHHLQDANRRRNLTWTKRLKICLGAARGLDYLHSGLGEDNRVIHRDIKSGNILLDENLDAKICDFGLSKESLRNQEDSSQVYTKVAGTNFYLDPIYLESGILRKESDVYSFGVVLFEMLSGMLVYHRRSLGDGKPQTLINLARRYYRNGLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G395550`
TK1151 ID	TkA02G395550
OH-1004 ID	LXL04_014807
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 92.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G395550

Location Chr02:100447133-100450189 (-)

Description Similar to PBL23: Probable serine/threonine-protein kinase PBL23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g20530`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At2g02800`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014807 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0043680 filiform apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G20530

ath:AT3G46290

ath:AT5G02290

ath:AT5G59700

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.461

Rank 1 · TkA02G395550 · TK1151

Cell membrane0.429

Rank 2 · TkA02G395550 · TK1151

Nucleus0.283

Rank 3 · TkA02G395550 · TK1151

Golgi apparatus0.043

Rank 4 · TkA02G395550 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA02G395550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-301 aa

PF07714PK_Tyr_Ser-Thr29-303 aa

PF03109ABC131-57 aa

PF01636APH137-166 aa

PF17667Pkinase_fungal142-198 aa

PF03109ABC1149-183 aa

PF12330Haspin_kinase153-195 aa

PF01757Acyl_transf_3212-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G395550	`PF00069`	Pkinase	27	301	2.7e-46	158.8
TkA02G395550	`PF07714`	PK_Tyr_Ser-Thr	29	303	7.1e-48	163.9
TkA02G395550	`PF03109`	ABC1	31	57	0.0038	17.2
TkA02G395550	`PF01636`	APH	137	166	0.079	13.4
TkA02G395550	`PF17667`	Pkinase_fungal	142	198	0.055	12.9
TkA02G395550	`PF03109`	ABC1	149	183	0.0038	17.2
TkA02G395550	`PF12330`	Haspin_kinase	153	195	0.0052	16.6
TkA02G395550	`PF01757`	Acyl_transf_3	212	259	0.27	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	41.500%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	40.700%	Swiss-Prot	Medium
`F4JEQ2`	Arabidopsis thaliana	sp\|F4JEQ2\|PBL23_ARATH Probable serine/threonine-protein kinase PBL23	40.200%	Swiss-Prot	Medium
`Q9FLJ8`	Arabidopsis thaliana	sp\|Q9FLJ8\|Y5613_ARATH Probable receptor-like protein kinase At5g61350	42.000%	Swiss-Prot	Medium
`O49840`	Arabidopsis thaliana	sp\|O49840\|PBL3_ARATH Probable serine/threonine-protein kinase PBL3	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card