LXL04_014807 | RubberDandelionOmics

Gene overview

LXL04_014807

Reference: OH-1004 Chr: Chr03 Coordinates: 57334474-57337386 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · LXL04_014807|LXL04_014807|OH1004|cDNA

ATGCAACTAACTCTAAGTAATCTCATTGTGTTTATCTTCATAAAATCACAATTTTACAAAGTCAACGCTATCAAAATAACCATGTCTTCTTCCGGTGTTAACCTAGAAAGTTTTCTAATTCCGCTGAAAGAGATCAACTTGGCAACTcaagacttcaaccccgaaaCACGCATCGGAGATGGTGGATTCGGTATGGTCCACAAAGGACAACTCTCAGAACCATGGCAAAACCGCACAGTTGCCATCAAACGCCTCGATCT...

CDS

Download CDS FASTA

1110 bp · LXL04_014807|LXL04_014807|OH1004|CDS

ATGCAACTAACTCTAAGTAATCTCATTGTGTTTATCTTCATAAAATCACAATTTTACAAAGTCAACGCTATCAAAATAACCATGTCTTCTTCCGGTGTTAACCTAGAAAGTTTTCTAATTCCGCTGAAAGAGATCAACTTGGCAACTCAAGACTTCAACCCCGAAACACGCATCGGAGATGGTGGATTCGGTATGGTCCACAAAGGACAACTCTCAGAACCATGGCAAAACCGCACAGTTGCCATCAAACGCCTCGATCT...

Protein

Download Protein FASTA

369 aa · LXL04_014807|LXL04_014807|OH1004|PROTEIN

MQLTLSNLIVFIFIKSQFYKVNAIKITMSSSGVNLESFLIPLKEINLATQDFNPETRIGDGGFGMVHKGQLSEPWQNRTVAIKRLDLKGYQGKDEFLTELKLISKFQHENIIRFVGYCDQGEEMILVYEYASNGSLDHHLQDANRRRNLTWTKRLKICLGAARGLDYLHSGLGEDNRVIHRDIKSGNILLDENLDAKICDFGLSKESLRNQEDSSQVYTKVAGTNFYLDPIYLESGILRKESDVYSFGVVLFEMLSGMLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014807`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014807

Location Chr03:57334474-57337386 (+)

Description Similar to PBL23: Probable serine/threonine-protein kinase PBL23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g20530`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0110900`	Functions downstream of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014807 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0043680 filiform apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G20530

ath:AT3G46290

ath:AT5G02290

ath:AT5G59700

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.438

Rank 1 · LXL04_014807 · OH-1004

Cytoplasm0.389

Rank 2 · LXL04_014807 · OH-1004

Nucleus0.250

Rank 3 · LXL04_014807 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_014807 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_014807 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase54-328 aa

PF07714.24PK_Tyr_Ser-Thr56-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014807	`PF00069.32`	Pkinase	54	328	3.4e-46	158.5
LXL04_014807	`PF07714.24`	PK_Tyr_Ser-Thr	56	330	9.4e-48	163.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	42.038%	Swiss-Prot	moderate database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	40.122%	Swiss-Prot	moderate database homology
`F4JEQ2`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL23	40.196%	Swiss-Prot	moderate database homology
`P43293`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL11	40.446%	Swiss-Prot	moderate database homology
`Q65XV8`	Oryza sativa subsp. japonica	Receptor-like cytoplasmic kinase 176	38.700%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card