TkA02G241940 | RubberDandelionOmics

Gene overview

TkA02G241940

Reference: TK1151 Chr: Chr02 Coordinates: 62161510-62164434 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1969 bp · TkA02G241940|TK1151|cDNA

GGACCATTGTAGTTAGATTTAATTAGCAACAGATATAATAGTGACTCCACTCTTTGAATTATATTTAGTATCCACTGGTTTCAAGATGCGCTTATGCAGAACAGCTTGAGCTACAACCTTCAATCTCAAACCAAGGTTACGAGTTGAAGTTACAGAACTTTCCAGGTGGAGCGGAAACGTTTGAAATGGTCCTGAAATTTTGTTACGGTTTTCTGGTATCTTTAAATCCAAGAAACGCAGCCCCAATAAGGTGTGCGGCG...

CDS

Download CDS FASTA

1569 bp · TkA02G241940|TK1151|CDS

ATGGTCCTGAAATTTTGTTACGGTTTTCTGGTATCTTTAAATCCAAGAAACGCAGCCCCAATAAGGTGTGCGGCGGAGTTCCTGGACATGACGGAGGAATTAGAAGAAGGAAACCTTATATCTAAATCCGAATCATTTCTCACGTTGGTAGTCTTTTCTTCATGGAAGGACTCGATTACTGTCCTAAAATCATGCGAAACTTTGTCTCCATGGGCTGAAAATCTCCAGATTGTACGAAGATGTTGTGATTCAATCGCTAG...

Protein

Download Protein FASTA

522 aa · TkA02G241940|TK1151|PROTEIN

MVLKFCYGFLVSLNPRNAAPIRCAAEFLDMTEELEEGNLISKSESFLTLVVFSSWKDSITVLKSCETLSPWAENLQIVRRCCDSIARAAEGYFTSTEAVNEQCRCLINDLATLQIDHFMRIMTSMTLKGLRPEFLGKCIVIYAEKWLSDTDVHIEGSKRATTGKNEIQWSIQPGLRSTGTELGEYQEQRRIIECLVSILPHQKDAISCKFLLWMLKMAILYSVSPAFISELEKRAGMVMENATVYDLLIPVYRIREQGNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G241940`
TK1151 ID	TkA02G241940
OH-1004 ID	LXL04_015905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 93.885 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G241940

Location Chr02:62161510-62164434 (+)

Description Similar to DOT3: BTB/POZ domain-containing protein DOT3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10250`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At5g64330`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Arabidopsis NPH3: A NPH1 photoreceptor-interacting protein essential for phototropism.1999 · DOI: 10.1126/science.286.5441.961 RPT2. A signal transducer of the phototropic response in Arabidopsis.2000 · DOI: 10.1105/tpc.12.2.225 RPT2 is a signal transducer involved in phototropic response and stomatal opening by association with phototropin 1 in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019901 PHYTOCHROME KINASE SUBSTRATE 1 is a phototropin 1 binding protein required for phototropism.2006 · DOI: 10.1073/pnas.0603799103 The Arabidopsis PHYTOCHROME KINASE SUBSTRATE2 protein is a phototropin signaling element that regulates leaf flattening and leaf positioning.2010 · DOI: 10.1104/pp.109.150441
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g67385`	Acts as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (Probable).	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0568200`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	The Rice COLEOPTILE PHOTOTROPISM1 gene encoding an ortholog of Arabidopsis NPH3 is required for phototropism of coleoptiles and lateral translocation of auxin.2005 · DOI: 10.1105/tpc.104.028357

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015905 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009904 chloroplast accumulation movement Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048367 shoot system development Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT5G10250

ath:AT5G13600

ath:AT5G66560

ath:AT5G67385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.551

Rank 1 · TkA02G241940 · TK1151

Cytoplasm0.342

Rank 2 · TkA02G241940 · TK1151

Cell membrane0.155

Rank 3 · TkA02G241940 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA02G241940 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA02G241940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000NPH3106-375 aa

PF30756LUZP2207-297 aa

PF16523betaPIX_CC231-257 aa

PF28878C3H64_C246-310 aa

PF09635MetRS-N265-325 aa

PF30756LUZP2381-455 aa

PF16523betaPIX_CC392-465 aa

PF11932DUF3450407-467 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G241940	`PF03000`	NPH3	106	375	3.2e-86	289.9
TkA02G241940	`PF30756`	LUZP2	207	297	0.016	15.3
TkA02G241940	`PF16523`	betaPIX_CC	231	257	0.31	11.7
TkA02G241940	`PF28878`	C3H64_C	246	310	0.023	15.5
TkA02G241940	`PF09635`	MetRS-N	265	325	0.079	14.2
TkA02G241940	`PF30756`	LUZP2	381	455	0.016	15.3
TkA02G241940	`PF16523`	betaPIX_CC	392	465	0.31	11.7
TkA02G241940	`PF11932`	DUF3450	407	467	0.016	15.2
TkA02G241940	`PF28878`	C3H64_C	446	459	0.023	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFU0`	Arabidopsis thaliana	sp\|Q9LFU0\|DOT3_ARATH BTB/POZ domain-containing protein DOT3	47.200%	Swiss-Prot	Medium
`Q9FMF5`	Arabidopsis thaliana	sp\|Q9FMF5\|RPT3_ARATH Root phototropism protein 3	36.700%	Swiss-Prot	Medium
`Q9S9Q9`	Arabidopsis thaliana	sp\|Q9S9Q9\|Y1044_ARATH BTB/POZ domain-containing protein At1g30440	37.700%	Swiss-Prot	Medium
`Q66GP0`	Arabidopsis thaliana	sp\|Q66GP0\|SR1P1_ARATH BTB/POZ domain-containing protein SR1IP1	37.000%	Swiss-Prot	Medium
`Q9FNB3`	Arabidopsis thaliana	sp\|Q9FNB3\|Y5360_ARATH Putative BTB/POZ domain-containing protein At5g13600	50.700%	Swiss-Prot	Medium
`Q5KS50`	Oryza sativa subsp. japonica	sp\|Q5KS50\|NPH3_ORYSJ Coleoptile phototropism protein 1	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card