LXL04_015905 | RubberDandelionOmics

Gene overview

LXL04_015905

Reference: OH-1004 Chr: Chr03 Coordinates: 97305553-97308610 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1671 bp · LXL04_015905|LXL04_015905|OH1004|cDNA

ATGTTGTTGCTAATCCAACAGCTTGAGCTACAACCTTCAATCTCAAACCAAGGTTACGAGTTGAAGTTACAGAACTTTCCAGGTGGAGCGGAAACGTTTGAAATGGTCCTGAAATTTTGTTACGGTTTTCCGGTATCTTTAAATCCAAGAAACGCAGCCCCAATAAGGTGTGCGGCGGAGTTCCTGGACATGACGGAGGAATTAGAAGAAGGAAACCTTATATCTAAATCCGAATCATTTCTCACGTTGGTAGTCTTTTC...

CDS

Download CDS FASTA

1671 bp · LXL04_015905|LXL04_015905|OH1004|CDS

ATGTTGTTGCTAATCCAACAGCTTGAGCTACAACCTTCAATCTCAAACCAAGGTTACGAGTTGAAGTTACAGAACTTTCCAGGTGGAGCGGAAACGTTTGAAATGGTCCTGAAATTTTGTTACGGTTTTCCGGTATCTTTAAATCCAAGAAACGCAGCCCCAATAAGGTGTGCGGCGGAGTTCCTGGACATGACGGAGGAATTAGAAGAAGGAAACCTTATATCTAAATCCGAATCATTTCTCACGTTGGTAGTCTTTTC...

Protein

Download Protein FASTA

556 aa · LXL04_015905|LXL04_015905|OH1004|PROTEIN

MLLLIQQLELQPSISNQGYELKLQNFPGGAETFEMVLKFCYGFPVSLNPRNAAPIRCAAEFLDMTEELEEGNLISKSESFLTLVVFSSWKDSITVLKSCETLSPWAENLQIVRRCCDSIARAAEGYFTSTEAVNEQCRCLINDLATLQIDHFMRIMTSMTLKGLRPEFLGKCIVIYAEKWLSDTDVHIEGSKRATTGKNEIQWSIQPGLRSTGTELGEYQEQRRIIECLVSILPHQKDAISCKFLLWMLKMAILYSVSPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015905`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015905

Location Chr03:97305553-97308610 (+)

Description Similar to DOT3: BTB/POZ domain-containing protein DOT3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10250`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g67385`	Acts as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (Probable).	No verified direct reference in this release
`At5g66560`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009904 chloroplast accumulation movement Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048367 shoot system development Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT5G10250

ath:AT5G13600

ath:AT5G66560

ath:AT5G67385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.540

Rank 1 · LXL04_015905 · OH-1004

Cytoplasm0.353

Rank 2 · LXL04_015905 · OH-1004

Cell membrane0.147

Rank 3 · LXL04_015905 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_015905 · OH-1004

Golgi apparatus0.034

Rank 5 · LXL04_015905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000.20NPH3140-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015905	`PF03000.20`	NPH3	140	409	2.3e-85	287.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFU0`	Arabidopsis thaliana	BTB/POZ domain-containing protein DOT3	52.805%	Swiss-Prot	strong database homology
`Q9S9Q9`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g30440	34.572%	Swiss-Prot	moderate database homology
`Q66GP0`	Arabidopsis thaliana	BTB/POZ domain-containing protein SR1IP1	36.226%	Swiss-Prot	moderate database homology
`Q94A73`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g66560	38.445%	Swiss-Prot	moderate database homology
`Q9FNB3`	Arabidopsis thaliana	Putative BTB/POZ domain-containing protein At5g13600	38.126%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card