TkA02G174710 | RubberDandelionOmics

Gene overview

TkA02G174710

Reference: TK1151 Chr: Chr02 Coordinates: 44996388-44999747 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2100 bp · TkA02G174710|TK1151|cDNA

CCCTGATGCATCCACCCCACCGCGGTTTCCCTTTCCGACGCCATATTAACCGGGAAAACAGGCTCTGTCACACATACTCTGTATCCCTAATTTCTAACCAGTAAAACGTAAGAGGTGATCGGAGGTAGAGAAACGGCTGAAAAATGGAGGTTATGAATAACAATCTGACATTGTTTTCCGATGTGGCGATGAACACCGACAGTACTCACAGTCAGGTCGTTCCGATCACATTATTCATTGCGGTACTCTGTGTATGTTTA...

CDS

Download CDS FASTA

1260 bp · TkA02G174710|TK1151|CDS

ATGCTATTTGGAATTACAGGCGTTCTGATATCAACATCAATCGTCGCAGCTGGTTGCTGGTGGCTGTTTCCAAAGTTAGGGTTTGAGGGTTTGAGTATCAGCGAGTATCTTAGTATTGGGACAATTTTCTCATCTACAGATACTGTATGCACATTACAGGTCTTGAGCCAAGATGAGACGCCATTGCTATACAGCTTAGTCTTTGGTGAAGGAGTAGTAAATGATGCAACATCAGTTGTACTTTTCAATGCGGTTCAAAA...

Protein

Download Protein FASTA

419 aa · TkA02G174710|TK1151|PROTEIN

MLFGITGVLISTSIVAAGCWWLFPKLGFEGLSISEYLSIGTIFSSTDTVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNAVQKINADTLNAQTALRIFLDFLYLFTTSTLLGVAAGLVTAYILRGLYVGRHSSVREIALMVLVAYLSYMLAELFELSGILTVFFTGVLMSHYSWHNVTESSRTTTRYAFATLSFIAETFIFLYVGMDAFDYEKWKMSKLSFWNKLAIYSTVMLLILIGRAAFVFPLSIISNYMHRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G174710`
TK1151 ID	TkA02G174710
OH-1004 ID	LXL04_016203
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 78.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G174710

Location Chr02:44996388-44999747 (-)

Description Similar to NHX4: Sodium/hydrogen exchanger 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55470`	May act in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes.	No verified direct reference in this release
`At5g27150`	Acts in low affinity electroneutral exchange of protons for cations such as Na⁺ or K⁺ across membranes.	Salt tolerance conferred by overexpression of a vacuolar Na+/H+ antiport in Arabidopsis.1999 · DOI: 10.1126/science.285.5431.1256 Functional conservation between yeast and plant endosomal Na(+)/H(+) antiporters.2000 · DOI: 10.1016/s0014-5793(00)01412-5 Arabidopsis thaliana and Saccharomyces cerevisiae NHX1 genes encode amiloride sensitive electroneutral Na+/H+ exchangers.2000 · DOI: 10.1042/0264-6021:3510241 Engineering salt-tolerant Brassica plants: characterization of yield and seed oil quality in transgenic plants with increased vacuolar sodium accumulation.2001 · DOI: 10.1073/pnas.231476498 The arabidopsis Na+/H+ exchanger AtNHX1 catalyzes low affinity Na+ and K+ transport in reconstituted liposomes.2002 · DOI: 10.1074/jbc.m105043200 Vacuolar cation/H+ exchange, ion homeostasis, and leaf development are altered in a T-DNA insertional mutant of AtNHX1, the Arabidopsis vacuolar Na+/H+ antiporter.2003 · DOI: 10.1046/j.1365-313x.2003.01871.x Expression of an Arabidopsis vacuolar sodium/proton antiporter gene in cotton improves photosynthetic performance under salt conditions and increases fiber yield in the field.2005 · DOI: 10.1093/pcp/pci201 The Arabidopsis thaliana proton transporters, AtNhx1 and Avp1, can function in cation detoxification in yeast.1999 · DOI: 10.1073/pnas.96.4.1480
`At3g05030`	Acts in low affinity electroneutral exchange of protons for cations such as Na⁺ or K⁺ across membranes.	Differential expression and function of Arabidopsis thaliana NHX Na+/H+ antiporters in the salt stress response.2002 · DOI: 10.1046/j.1365-313x.2002.01309.x
`At3g06370`	May act in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0666900`	May act as a vacuolar antiporter mediating low-affinity electroneutral exchange of H⁺ for cations such as Na⁺ and K⁺.	Function, intracellular localization and the importance in salt tolerance of a vacuolar Na(+)/H(+) antiporter from rice.2004 · DOI: 10.1093/pcp/pch014

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016203 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0009651 response to salt stress Biological Process

GO:0034486 vacuolar transmembrane transport Biological Process

GO:0048366 leaf development Biological Process

GO:0051453 regulation of intracellular pH Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0098719 sodium ion import across plasma membrane Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0000139 Golgi membrane Cellular Component

KEGG gene cross-reference

ath:AT3G05030

ath:AT3G06370

ath:AT5G27150

ath:AT5G55470

dosa:Os07g0666900

osa:4344217

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.480

Rank 1 · TkA02G174710 · TK1151

Cell membrane0.213

Rank 2 · TkA02G174710 · TK1151

Cytoplasm0.199

Rank 3 · TkA02G174710 · TK1151

Golgi apparatus0.132

Rank 4 · TkA02G174710 · TK1151

Endoplasmic reticulum0.127

Rank 5 · TkA02G174710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999Na_H_Exchanger2-331 aa

PF19094EMC6_arch110-158 aa

PF19094EMC6_arch174-218 aa

PF12963DUF3852189-239 aa

PF15183MRAP232-277 aa

PF19094EMC6_arch278-324 aa

PF12963DUF3852283-330 aa

PF15183MRAP314-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G174710	`PF00999`	Na_H_Exchanger	2	331	3.3e-45	155.3
TkA02G174710	`PF19094`	EMC6_arch	110	158	2.6	9.3
TkA02G174710	`PF19094`	EMC6_arch	174	218	2.6	9.3
TkA02G174710	`PF12963`	DUF3852	189	239	1.5	10.1
TkA02G174710	`PF15183`	MRAP	232	277	2.6	8.9
TkA02G174710	`PF19094`	EMC6_arch	278	324	2.6	9.3
TkA02G174710	`PF12963`	DUF3852	283	330	1.5	10.1
TkA02G174710	`PF15183`	MRAP	314	320	2.6	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S397`	Arabidopsis thaliana	sp\|Q8S397\|NHX4_ARATH Sodium/hydrogen exchanger 4	66.900%	Swiss-Prot	High
`Q68KI4`	Arabidopsis thaliana	sp\|Q68KI4\|NHX1_ARATH Sodium/hydrogen exchanger 1	56.400%	Swiss-Prot	High
`Q56XP4`	Arabidopsis thaliana	sp\|Q56XP4\|NHX2_ARATH Sodium/hydrogen exchanger 2	56.400%	Swiss-Prot	High
`Q84WG1`	Arabidopsis thaliana	sp\|Q84WG1\|NHX3_ARATH Sodium/hydrogen exchanger 3	61.500%	Swiss-Prot	High
`Q9SXJ8`	Oryza sativa subsp. japonica	sp\|Q9SXJ8\|NHX1_ORYSJ Sodium/hydrogen exchanger 1	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card