TkA02G097950 | RubberDandelionOmics

Gene overview

TkA02G097950

Reference: TK1151 Chr: Chr02 Coordinates: 25628796-25631041 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

731 bp · TkA02G097950|TK1151|cDNA

TTGCCATTGTTGCAGTGCAGACCGAATGGATTTCTCTCAGCTCACAGACGCAATGGCGTCAAGATCGTACGACAAAGTGGCTGATGTCTGTGATCAGCTTATGCTTCAGATTGCTTCACAAGGCGTTGCATTTCAAGACGAATGGCCGTATGCTGTTCATCTTCTAGGGCACATTTACCTTAACGATCTAAATAGTGCTCGGTTTCTATGGAAATCTGTACCAAATTCAGTCAAAGAAAGCCGCCCTGAAGTGGCGGCAG...

CDS

Download CDS FASTA

594 bp · TkA02G097950|TK1151|CDS

ATGGATTTCTCTCAGCTCACAGACGCAATGGCGTCAAGATCGTACGACAAAGTGGCTGATGTCTGTGATCAGCTTATGCTTCAGATTGCTTCACAAGGCGTTGCATTTCAAGACGAATGGCCGTATGCTGTTCATCTTCTAGGGCACATTTACCTTAACGATCTAAATAGTGCTCGGTTTCTATGGAAATCTGTACCAAATTCAGTCAAAGAAAGCCGCCCTGAAGTGGCGGCAGTTTGGAAAATAGGGCAGCAGTTGTG...

Protein

Download Protein FASTA

197 aa · TkA02G097950|TK1151|PROTEIN

MDFSQLTDAMASRSYDKVADVCDQLMLQIASQGVAFQDEWPYAVHLLGHIYLNDLNSARFLWKSVPNSVKESRPEVAAVWKIGQQLWVRNYAGVYDSIRGFNWSAEIQDFIASFAERYTRRMLELLMSAYSTISIQDTALFLGMNENDATNYVMQQGWSVDVASKMLTVKKQVIVTEQKIDPSKLQRLTEYVFHLEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G097950`
TK1151 ID	TkA02G097950
OH-1004 ID	LXL04_016846
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.300
Protein coverage (%)	TK1151 100.000 / OH-1004 68.504 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G097950

Location Chr02:25628796-25631041 (+)

Description Similar to CSN8: COP9 signalosome complex subunit 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14110`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	Interactions of the COP9 signalosome with the E3 ubiquitin ligase SCFTIRI in mediating auxin response.2001 · DOI: 10.1126/science.1059776

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016846 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010387 COP9 signalosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008180 COP9 signalosome Cellular Component

KEGG gene cross-reference

ath:AT4G14110

dre:393198

pon:100171561

xla:443917

xtr:394711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.665

Rank 1 · TkA02G097950 · TK1151

Nucleus0.413

Rank 2 · TkA02G097950 · TK1151

Golgi apparatus0.072

Rank 3 · TkA02G097950 · TK1151

Lysosome / Vacuole0.069

Rank 4 · TkA02G097950 · TK1151

Endoplasmic reticulum0.064

Rank 5 · TkA02G097950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10075CSN8_PSD8_EIF3K5-20 aa

PF24767UBA_At5g587205-19 aa

PF10075CSN8_PSD8_EIF3K39-174 aa

PF29883DUF859761-108 aa

PF29883DUF8597106-156 aa

PF13852DUF4197107-156 aa

PF01399PCI108-155 aa

PF24767UBA_At5g58720120-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G097950	`PF10075`	CSN8_PSD8_EIF3K	5	20	4e-36	124.9
TkA02G097950	`PF24767`	UBA_At5g58720	5	19	0.17	12.4
TkA02G097950	`PF10075`	CSN8_PSD8_EIF3K	39	174	4e-36	124.9
TkA02G097950	`PF29883`	DUF8597	61	108	0.15	13.0
TkA02G097950	`PF29883`	DUF8597	106	156	0.15	13.0
TkA02G097950	`PF13852`	DUF4197	107	156	0.031	14.6
TkA02G097950	`PF01399`	PCI	108	155	0.13	13.2
TkA02G097950	`PF24767`	UBA_At5g58720	120	139	0.17	12.4
TkA02G097950	`PF20957`	GxGYxYP_N_2nd	155	181	0.097	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43255`	Arabidopsis thaliana	sp\|P43255\|CSN8_ARATH COP9 signalosome complex subunit 8	60.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card