LXL04_016846 | RubberDandelionOmics

Gene overview

LXL04_016846

Reference: OH-1004 Chr: Chr03 Coordinates: 135534445-135537068 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · LXL04_016846|LXL04_016846|OH1004|cDNA

ATGGGGCTGCTGTGGAGGTGGAGGGTTTCGCGATGGGGCTGCTGTGGAGGTGGAGGGTTTCGCTCTAGGAGCAGCGATGGAGGATACCGACGGTGCAACAGCGGCGCTGGACAGAGGTCGACGCACAGAGGTGTTTGCAGTGGCGGTCGACGGAGGTATAAGGCTGTCAATGGAGTTCTAGGGtgcgaggaagaagaagaagaagagaggggGAAAGGGGGCTGCCGTGGTGCAGACCGAATGGATTTCTCTCAGCTCAC...

CDS

Download CDS FASTA

765 bp · LXL04_016846|LXL04_016846|OH1004|CDS

ATGGGGCTGCTGTGGAGGTGGAGGGTTTCGCGATGGGGCTGCTGTGGAGGTGGAGGGTTTCGCTCTAGGAGCAGCGATGGAGGATACCGACGGTGCAACAGCGGCGCTGGACAGAGGTCGACGCACAGAGGTGTTTGCAGTGGCGGTCGACGGAGGTATAAGGCTGTCAATGGAGTTCTAGGGTGCGAGGAAGAAGAAGAAGAAGAGAGGGGGAAAGGGGGCTGCCGTGGTGCAGACCGAATGGATTTCTCTCAGCTCAC...

Protein

Download Protein FASTA

254 aa · LXL04_016846|LXL04_016846|OH1004|PROTEIN

MGLLWRWRVSRWGCCGGGGFRSRSSDGGYRRCNSGAGQRSTHRGVCSGGRRRYKAVNGVLGCEEEEEEERGKGGCRGADRMDFSQLTDAMASRSYDKVADVCDQLMLQIASQGVAFQDEWPYAVHLLGHIYLNDLNSARFLWKSVPNSVKESRPEVAAVWKIGQQLWVRNYAERYTRRMLELLMSAYSTISIQDTALFLGMNENDATNYVMQQGWSVDVASKMLTVKKQVIVTEQKIDPSKLQRLTEYVFHLEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016846`
TK1151 ID	TkA02G097950
OH-1004 ID	LXL04_016846
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.300
Protein coverage (%)	TK1151 100.000 / OH-1004 68.504 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016846

Location Chr03:135534445-135537068 (-)

Description Similar to CSN8: COP9 signalosome complex subunit 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14110`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	Interactions of the COP9 signalosome with the E3 ubiquitin ligase SCFTIRI in mediating auxin response.2001 · DOI: 10.1126/science.1059776

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016846 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010387 COP9 signalosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008180 COP9 signalosome Cellular Component

KEGG gene cross-reference

ath:AT4G14110

dre:393198

pon:100171561

xla:443917

xtr:394711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.370

Rank 1 · LXL04_016846 · OH-1004

Nucleus0.260

Rank 2 · LXL04_016846 · OH-1004

Mitochondrion0.203

Rank 3 · LXL04_016846 · OH-1004

Plastid0.144

Rank 4 · LXL04_016846 · OH-1004

Peroxisome0.092

Rank 5 · LXL04_016846 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10075.16CSN8_PSD8_EIF3K119-176 aa

PF10075.16CSN8_PSD8_EIF3K174-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016846	`PF10075.16`	CSN8_PSD8_EIF3K	119	176	1.1e-23	84.6
LXL04_016846	`PF10075.16`	CSN8_PSD8_EIF3K	174	231	1.1e-23	84.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43255`	Arabidopsis thaliana	COP9 signalosome complex subunit 8	54.822%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card