TkA01G419090 | RubberDandelionOmics

Gene overview

TkA01G419090

Reference: TK1151 Chr: Chr01 Coordinates: 104641638-104644914 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3185 bp · TkA01G419090|TK1151|cDNA

ATAAGAAAACATCCAACATGAGTAAAAATGATTTCTACCACCACACACATCAAAACACACTCGAAACGCACACAGTATTGCATCATTGAATACTAAGCTTTTTCTGAAAATTTCACCAACCCTTGGCACATTTATTAACTCCATCCACTCTCCACAATTTCTCCACTCACTCTTTTCACTAAAAACTGCCGAATGCTCCATTCCCAACATCTCACACCTCCTTTTTCTGGTTTATCAGCTAAAGTGTGAAGCCTTTTCGC...

CDS

Download CDS FASTA

2448 bp · TkA01G419090|TK1151|CDS

ATGGGTATACATTCTTCATCTTCACAAGTTTACAATCTATCGTCGTCTGTTTGTTCATGGAAGTTTGTGTCCTGTGATGCTAAACAACAAAATGTAATTGGTCTTGTTGCTCCTAATTTGGGCCTCACTGGTCCCATTCCCGATAACACCATTGGCAAACTCAAAAAGCTTCAAATTCTTGATTTAAACAGTAACCATATCACTGATTTCTCATCTGATTTTTGGAGTTTAAGTTCGCTCACAATGCTTAATCTTTCAAA...

Protein

Download Protein FASTA

815 aa · TkA01G419090|TK1151|PROTEIN

MGIHSSSSQVYNLSSSVCSWKFVSCDAKQQNVIGLVAPNLGLTGPIPDNTIGKLKKLQILDLNSNHITDFSSDFWSLSSLTMLNLSNNKFSVNLPSNIDNFVSLEKLDLSSNNFSGRLPDSFDSLPSLQVLNLNRNQFDSIVPLGIISCHSLISVDFSMNSFHGSLPDGFDSAFPKLRSLNLAGNGIKGRGSDFSKMVSLTYLNISDNLFTGSVVEIFKGPLEVVDLSSNHFEGHISQVNFSSSFNWSRLVHLDLSDNEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G419090`
TK1151 ID	TkA01G419090
OH-1004 ID	LXL04_002812
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 94.767 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G419090

Location Chr01:104641638-104644914 (-)

Description Similar to At2g24230: Probable LRR receptor-like serine/threonine-protein kinase At2g24230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24230`	Probable LRR receptor-like serine/threonine-protein kinase At2g24230.	No verified direct reference in this release
`At5g58150`	Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150.	No verified direct reference in this release
`At5g45800`	Can phosphorylate the myelin basic protein in vitro.	A receptor-like kinase from Arabidopsis thaliana is a calmodulin-binding protein.2004 · DOI: 10.1042/bj20031045
`At4g39400`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.1999 · DOI: 10.1104/pp.121.3.743 Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.2000 · DOI: 10.1104/pp.123.4.1247 The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.2004 · DOI: 10.1105/tpc.104.023903 The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.2007 · DOI: 10.1371/journal.pone.0000449 BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
`At3g13380`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002812 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009556 microsporogenesis Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019199 transmembrane receptor protein kinase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24230

ath:AT5G07280

ath:AT5G58150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.846

Rank 1 · TkA01G419090 · TK1151

Endoplasmic reticulum0.088

Rank 2 · TkA01G419090 · TK1151

Cytoplasm0.076

Rank 3 · TkA01G419090 · TK1151

Nucleus0.068

Rank 4 · TkA01G419090 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA01G419090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_846-90 aa

PF23211LRR_LRWD147-115 aa

PF23598LRR_1450-140 aa

PF12799LRR_451-71 aa

PF25013LRR_Zer-151-113 aa

PF14580LRR_951-136 aa

PF24048LRR_NXF1-551-90 aa

PF12799LRR_455-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G419090	`PF13855`	LRR_8	46	90	3.7e-33	113.8
TkA01G419090	`PF23211`	LRR_LRWD1	47	115	0.00081	19.9
TkA01G419090	`PF23598`	LRR_14	50	140	6.4e-16	58.8
TkA01G419090	`PF12799`	LRR_4	51	71	5.7e-31	106.5
TkA01G419090	`PF25013`	LRR_Zer-1	51	113	0.00027	21.8
TkA01G419090	`PF14580`	LRR_9	51	136	0.0031	17.8
TkA01G419090	`PF24048`	LRR_NXF1-5	51	90	0.0041	17.5
TkA01G419090	`PF12799`	LRR_4	55	90	5.7e-31	106.5
TkA01G419090	`PF13516`	LRR_6	55	69	1.3e-11	44.3
TkA01G419090	`PF00560`	LRR_1	56	76	1.1e-29	96.7
TkA01G419090	`PF24758`	LRR_At5g56370	56	136	1e-05	26.1
TkA01G419090	`PF07723`	LRR_2	56	69	5.8	8.5
TkA01G419090	`PF00069`	Pkinase	65	84	6.3e-29	101.9
TkA01G419090	`PF29594`	LRR_SKP2	71	135	0.61	10.0
TkA01G419090	`PF23952`	LRR_EndoS	73	112	0.28	12.1
TkA01G419090	`PF13516`	LRR_6	78	90	1.3e-11	44.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGK9`	Arabidopsis thaliana	sp\|C0LGK9\|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230	66.800%	Swiss-Prot	High
`Q9LVN2`	Arabidopsis thaliana	sp\|Q9LVN2\|Y5815_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150	52.300%	Swiss-Prot	High
`Q9FK63`	Arabidopsis thaliana	sp\|Q9FK63\|CARLK_ARATH Calmodulin-binding receptor kinase CaMRLK	43.900%	Swiss-Prot	Low
`O22476`	Arabidopsis thaliana	sp\|O22476\|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1	39.100%	Swiss-Prot	Medium
`Q9LJF3`	Arabidopsis thaliana	sp\|Q9LJF3\|BRL3_ARATH Receptor-like protein kinase BRI1-like 3	36.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card