RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_002812
Reference: OH-1004 Chr: Chr01 Coordinates: 58805693-58808275 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2583 bp · LXL04_002812|LXL04_002812|OH1004|cDNA

ATGGGGTTTGCTTTGTTGTTAGGTTCCATTTTGATTCTCACACTCTTCTTGAAGTCAAACCTTGGTCAACAACAAGAACAGTCTATACCTATACCTAATACAGATGAGTTCTTCATTTctaattttttcgaaaaaatgGGTATACATTCTTCATCTTCACAAGTTTACAATCTATCGTCGTCTGTTTGTTCATGGAAGTTTGTGTCCTGTGATGCTAAACAACAAAATGTAATTGGTCTTGTTGCTCCTAATTTGGGCCT...

CDS

Download CDS FASTA

2583 bp · LXL04_002812|LXL04_002812|OH1004|CDS

ATGGGGTTTGCTTTGTTGTTAGGTTCCATTTTGATTCTCACACTCTTCTTGAAGTCAAACCTTGGTCAACAACAAGAACAGTCTATACCTATACCTAATACAGATGAGTTCTTCATTTCTAATTTTTTCGAAAAAATGGGTATACATTCTTCATCTTCACAAGTTTACAATCTATCGTCGTCTGTTTGTTCATGGAAGTTTGTGTCCTGTGATGCTAAACAACAAAATGTAATTGGTCTTGTTGCTCCTAATTTGGGCCT...

Protein

Download Protein FASTA

860 aa · LXL04_002812|LXL04_002812|OH1004|PROTEIN

MGFALLLGSILILTLFLKSNLGQQQEQSIPIPNTDEFFISNFFEKMGIHSSSSQVYNLSSSVCSWKFVSCDAKQQNVIGLVAPNLGLTGPIPDNTIGKLKKLQILDLNSNHITDFSSDFWSLSSLTMLNLSNNKFSVNLPSNIDNFVSLEKLDLSSNNFSGRLPDSFDSLPSLQVLNLNRNQFDSIVPLGIISCHSLISVDFSMNSFHGSLPDGFDSAFPKLRSLNLAGNGIKGRGSDFSKMVSLTYLNISDNLFTGSVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_002812
TK1151 IDTkA01G419090
OH-1004 IDLXL04_002812
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 94.767
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_002812
LocationChr01:58805693-58808275 (+)
DescriptionSimilar to At2g24230: Probable LRR receptor-like serine/threonine-protein kinase At2g24230
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g24230 Probable LRR receptor-like serine/threonine-protein kinase At2g24230. No verified direct reference in this release
At5g58150 Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150. No verified direct reference in this release
At5g07280 Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities. No verified direct reference in this release
At4g39400 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.
Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.1999 · DOI: 10.1104/pp.121.3.743
Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.2000 · DOI: 10.1104/pp.123.4.1247
The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.2004 · DOI: 10.1105/tpc.104.023903
The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.2007 · DOI: 10.1371/journal.pone.0000449
BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973
Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106
BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0917500 Receptor-like kinase that plays important roles in restricting the number of cells entering into male and female sporogenesis.
The MSP1 gene is necessary to restrict the number of cells entering into male and female sporogenesis and to initiate anther wall formation in rice.2003 · DOI: 10.1105/tpc.012401
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002812 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009556 microsporogenesis Biological Process
GO:0010234 anther wall tapetum cell fate specification Biological Process
GO:0045088 regulation of innate immune response Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0019199 transmembrane receptor protein kinase activity Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT2G24230
ath:AT5G07280
ath:AT5G58150
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.848
Rank 1 · LXL04_002812 · OH-1004
Endoplasmic reticulum0.093
Rank 2 · LXL04_002812 · OH-1004
Cytoplasm0.071
Rank 3 · LXL04_002812 · OH-1004
Nucleus0.062
Rank 4 · LXL04_002812 · OH-1004
Lysosome / Vacuole0.029
Rank 5 · LXL04_002812 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_891-135 aa
PF23598.2LRR_1495-184 aa
PF12799.14LRR_4100-135 aa
PF12799.14LRR_4124-163 aa
PF13855.13LRR_8148-197 aa
PF12799.14LRR_4148-187 aa
PF13855.13LRR_8210-254 aa
PF12799.14LRR_4220-253 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_002812PF13855.13LRR_8911354.2e-33113.6
LXL04_002812PF23598.2LRR_14951847.2e-1658.6
LXL04_002812PF12799.14LRR_41001351e-30105.8
LXL04_002812PF12799.14LRR_41241631e-30105.8
LXL04_002812PF13855.13LRR_81481974.2e-33113.6
LXL04_002812PF12799.14LRR_41481871e-30105.8
LXL04_002812PF13855.13LRR_82102544.2e-33113.6
LXL04_002812PF12799.14LRR_42202531e-30105.8
LXL04_002812PF13855.13LRR_82673294.2e-33113.6
LXL04_002812PF23598.2LRR_143053927.2e-1658.6
LXL04_002812PF12799.14LRR_43183591e-30105.8
LXL04_002812PF13855.13LRR_83403774.2e-33113.6
LXL04_002812PF12799.14LRR_43663991e-30105.8
LXL04_002812PF12799.14LRR_43884241e-30105.8
LXL04_002812PF07714.24PK_Tyr_Ser-Thr5617824.1e-29102.4
LXL04_002812PF00069.32Pkinase5617917.2e-29101.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGK9Arabidopsis thalianaProbable LRR receptor-like serine/threonine-protein kinase At2g2423062.140%Swiss-Protstrong database homology
Q9LVN2Arabidopsis thalianaProbably inactive leucine-rich repeat receptor-like protein kinase At5g5815046.828%Swiss-Protmoderate database homology
Q9LYN8Arabidopsis thalianaLeucine-rich repeat receptor protein kinase EMS132.483%Swiss-Protmoderate database homology
O22476Arabidopsis thalianaProtein BRASSINOSTEROID INSENSITIVE 133.123%Swiss-Protmoderate database homology
Q8RZV7Oryza sativa subsp. japonicaLeucine-rich repeat receptor protein kinase MSP134.363%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser