TkA01G324110 | RubberDandelionOmics

Gene overview

TkA01G324110

Reference: TK1151 Chr: Chr01 Coordinates: 80655737-80657100 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · TkA01G324110|TK1151|cDNA

ATGAAACCAAAAGAAGAAAGCAAATCAATAAATAACGCTCCACAGATGTATGAAAAGTCAAATGATCCGACTAAAGGAAAGAAGGAATCCATTGAATCAATCCGATATCACAAACTTTTTGCATTTGCTGACTCCATCGATTTTGTGCTAATGGTGCTCGGTACAATTACTGCAATTGGAGGCGGGATCAGTATGCCTTTACAAACATTGATATTTGGTGAGCTAATTGACACATTTGGAGGCAATACTGTTAACAACGC...

CDS

Download CDS FASTA

810 bp · TkA01G324110|TK1151|CDS

ATGAAACCAAAAGAAGAAAGCAAATCAATAAATAACGCTCCACAGATGTATGAAAAGTCAAATGATCCGACTAAAGGAAAGAAGGAATCCATTGAATCAATCCGATATCACAAACTTTTTGCATTTGCTGACTCCATCGATTTTGTGCTAATGGTGCTCGGTACAATTACTGCAATTGGAGGCGGGATCAGTATGCCTTTACAAACATTGATATTTGGTGAGCTAATTGACACATTTGGAGGCAATACTGTTAACAACGC...

Protein

Download Protein FASTA

269 aa · TkA01G324110|TK1151|PROTEIN

MKPKEESKSINNAPQMYEKSNDPTKGKKESIESIRYHKLFAFADSIDFVLMVLGTITAIGGGISMPLQTLIFGELIDTFGGNTVNNAIVHEVSKVSLKYVYLALGTGAATFSHVVCWMVTGERQATRIRSLYLKTILRQEVGFFDVESKTGEIIECLSTDTVIIQDAMGEKVGNFIQLISTFFGGFAVAFSEGWLLSVVLLSSIPLLVISATFMIVVMAKLKSKGQSAYSLGATVVEQTISSIKIVSICLSKHTTFIIYF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G324110`
TK1151 ID	TkA01G324110
OH-1004 ID	LXL04_003667
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G324110

Location Chr01:80655737-80657100 (+)

Description Similar to ABCB11: ABC transporter B family member 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02520`	Involved in the regulation of auxin transport required for pistil elongation.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At1g02530`	ABC transporter B family member 12.	No verified direct reference in this release
`At2g47000`	Auxin influx transporter that mediates the transport of auxin in roots.	PGP4, an ATP binding cassette P-glycoprotein, catalyzes auxin transport in Arabidopsis thaliana roots.2005 · DOI: 10.1105/tpc.105.035816
`At4g01820`	ABC transporter B family member 3.	No verified direct reference in this release
`At3g62150`	ABC transporter B family member 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003667 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0060919 auxin import into cell Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G02520

ath:AT2G47000

ath:AT3G62150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.453

Rank 1 · TkA01G324110 · TK1151

Lysosome / Vacuole0.305

Rank 2 · TkA01G324110 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA01G324110 · TK1151

Cytoplasm0.088

Rank 4 · TkA01G324110 · TK1151

Golgi apparatus0.053

Rank 5 · TkA01G324110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03458Gly_transporter48-63 aa

PF00664ABC_membrane51-246 aa

PF03458Gly_transporter79-111 aa

PF03458Gly_transporter199-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G324110	`PF03458`	Gly_transporter	48	63	3.1	8.5
TkA01G324110	`PF00664`	ABC_membrane	51	246	1.5e-39	137.1
TkA01G324110	`PF03458`	Gly_transporter	79	111	3.1	8.5
TkA01G324110	`PF03458`	Gly_transporter	199	214	3.1	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWX7`	Arabidopsis thaliana	sp\|Q9FWX7\|AB11B_ARATH ABC transporter B family member 11	58.600%	Swiss-Prot	High
`Q9FWX8`	Arabidopsis thaliana	sp\|Q9FWX8\|AB12B_ARATH ABC transporter B family member 12	58.900%	Swiss-Prot	High
`O80725`	Arabidopsis thaliana	sp\|O80725\|AB4B_ARATH ABC transporter B family member 4	58.300%	Swiss-Prot	High
`Q9SYI2`	Arabidopsis thaliana	sp\|Q9SYI2\|AB3B_ARATH ABC transporter B family member 3	57.500%	Swiss-Prot	High
`Q9M1Q9`	Arabidopsis thaliana	sp\|Q9M1Q9\|AB21B_ARATH ABC transporter B family member 21	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card