LXL04_003667 | RubberDandelionOmics

Gene overview

LXL04_003667

Reference: OH-1004 Chr: Chr01 Coordinates: 93026783-93028146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · LXL04_003667|LXL04_003667|OH1004|cDNA

ATGAAACCAAAAGAAGAAAGCAAATCAATAAATAACGCTCCACAGATGTATGAAAAGTCAAATGATCcgactaaaggaaagaaggaATCCATTGAATCAATCCGATATCACAAACTTTTTGCATTTGCTGACTCCATCGATTTTGTGCTAATGGTGCTCGGTACAATTACTGCAATTGGAGGCGGGATCAGTATGCCTTTACAAACATTGATATTTGGTGAGCTAATTGACACATTTGGAGGCAATACTGTTAACAACGC...

CDS

Download CDS FASTA

810 bp · LXL04_003667|LXL04_003667|OH1004|CDS

ATGAAACCAAAAGAAGAAAGCAAATCAATAAATAACGCTCCACAGATGTATGAAAAGTCAAATGATCCGACTAAAGGAAAGAAGGAATCCATTGAATCAATCCGATATCACAAACTTTTTGCATTTGCTGACTCCATCGATTTTGTGCTAATGGTGCTCGGTACAATTACTGCAATTGGAGGCGGGATCAGTATGCCTTTACAAACATTGATATTTGGTGAGCTAATTGACACATTTGGAGGCAATACTGTTAACAACGC...

Protein

Download Protein FASTA

269 aa · LXL04_003667|LXL04_003667|OH1004|PROTEIN

MKPKEESKSINNAPQMYEKSNDPTKGKKESIESIRYHKLFAFADSIDFVLMVLGTITAIGGGISMPLQTLIFGELIDTFGGNTVNNAIVHEVSKVSLKYVYLALGTGAATFSHVVCWMVTGERQATRIRSLYLKTILRQEVGFFDVESKTGEIIECLSTDTVIIQDAMGEKVGNFIQLISTFFGGFAVAFSEGWLLFVVLLSSIPLLVISATFMIVVMAKLKSKGQSAYSLGATVVEQTISSIKIVSICLSKHTTFIIYF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003667`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003667

Location Chr01:93026783-93028146 (-)

Description Similar to ABCB11: ABC transporter B family member 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02520`	Involved in the regulation of auxin transport required for pistil elongation.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At3g62150`	ABC transporter B family member 21.	No verified direct reference in this release
`At2g47000`	Auxin influx transporter that mediates the transport of auxin in roots.	PGP4, an ATP binding cassette P-glycoprotein, catalyzes auxin transport in Arabidopsis thaliana roots.2005 · DOI: 10.1105/tpc.105.035816
`At4g01820`	ABC transporter B family member 3.	No verified direct reference in this release
`At1g02530`	ABC transporter B family member 12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003667 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0060919 auxin import into cell Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G02520

ath:AT2G47000

ath:AT3G62150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.465

Rank 1 · LXL04_003667 · OH-1004

Lysosome / Vacuole0.293

Rank 2 · LXL04_003667 · OH-1004

Endoplasmic reticulum0.123

Rank 3 · LXL04_003667 · OH-1004

Cytoplasm0.088

Rank 4 · LXL04_003667 · OH-1004

Golgi apparatus0.052

Rank 5 · LXL04_003667 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane51-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003667	`PF00664.29`	ABC_membrane	51	246	1.5e-39	137.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWX7`	Arabidopsis thaliana	ABC transporter B family member 11	60.930%	Swiss-Prot	strong database homology
`Q9M1Q9`	Arabidopsis thaliana	ABC transporter B family member 21	55.708%	Swiss-Prot	strong database homology
`O80725`	Arabidopsis thaliana	ABC transporter B family member 4	58.605%	Swiss-Prot	strong database homology
`Q9SYI2`	Arabidopsis thaliana	ABC transporter B family member 3	57.273%	Swiss-Prot	strong database homology
`Q9FWX8`	Arabidopsis thaliana	ABC transporter B family member 12	58.036%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card