LXL04_030303 | RubberDandelionOmics

Gene overview

LXL04_030303

Reference: OH-1004 Chr: Chr06 Coordinates: 113856498-113859782 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2430 bp · LXL04_030303|LXL04_030303|OH1004|cDNA

ATGAAAGGCAAACCTAATAAAGGCAAAGCGAACGGCAACGGTTAAGTCACTGTTCATCCCATCGGCCGGGTCCCCAACGGCAACCAGTCACGGTTTTCTTCAGCTACATTTCCCTATGAGAACTCAATGCTCGCTGCTACATTTTCCTCCAAATCTCTAGCCAACAACTGCAACAGTGAGCTTCTTCCAAAGATGAGTGAATCGGAGCTTGCCGGGGAGTACAGAGACCGGAATGTGGCCGGAGGTCGGACAGTTGTGGT...

CDS

Download CDS FASTA

2304 bp · LXL04_030303|LXL04_030303|OH1004|CDS

ATGCTCGCTGCTACATTTTCCTCCAAATCTCTAGCCAACAACTGCAACAGTGAGCTTCTTCCAAAGATGAGTGAATCGGAGCTTGCCGGGGAGTACAGAGACCGGAATGTGGCCGGAGGTCGGACAGTTGTGGTTGGAGTTAAGCTTGACTCGCAGAGTAGAGAGTTGCTAACTTGGGCTTTAGTCAAACAAGCTCAACCTGGTGACCGTGTTGTCGCTCTTCATGTTCTTACCAACAATGAAATTCTGGATCATGAAGG...

Protein

Download Protein FASTA

767 aa · LXL04_030303|LXL04_030303|OH1004|PROTEIN

MLAATFSSKSLANNCNSELLPKMSESELAGEYRDRNVAGGRTVVVGVKLDSQSRELLTWALVKQAQPGDRVVALHVLTNNEILDHEGKSSLLSLVNSFDSVLAVYEGFCNLKQVDLKLKICRGTSIRKIIVREAKSYNANEIIVGTARVHHTIRSSSSVAKYCAKKLKNCSIIAVSSGKIVFHRQSPSSTSGAKGSSDHHKNQIFSLIQRSLSLTPTLLNNGNELKCNQTDCKKPDLALVKSESECAPIAFRNNCPICSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030303`
TK1151 ID	TkA07G395900
OH-1004 ID	LXL04_030303
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 94.808 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030303

Location Chr06:113856498-113859782 (+)

Description Similar to PERK1: Proline-rich receptor-like protein kinase PERK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16750`	Promotes cell proliferation in the gibberellic acid (GA) signaling pathway, acting downstream of RGA, and possibly through a negative regulation of two cyclin-dependent kinase inhibitors SIM and SMR1.	No verified direct reference in this release
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030303 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G70460

ath:AT2G16750

ath:AT3G05140

ath:AT3G24550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.535

Rank 1 · LXL04_030303 · OH-1004

Cytoplasm0.312

Rank 2 · LXL04_030303 · OH-1004

Nucleus0.296

Rank 3 · LXL04_030303 · OH-1004

Endoplasmic reticulum0.045

Rank 4 · LXL04_030303 · OH-1004

Plastid0.038

Rank 5 · LXL04_030303 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00582.33Usp41-168 aa

PF00069.32Pkinase421-629 aa

PF07714.24PK_Tyr_Ser-Thr421-687 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030303	`PF00582.33`	Usp	41	168	3.1e-07	31.7
LXL04_030303	`PF00069.32`	Pkinase	421	629	5e-43	148.1
LXL04_030303	`PF07714.24`	PK_Tyr_Ser-Thr	421	687	1.8e-41	142.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B5X4Z9`	Arabidopsis thaliana	Protein kinase STUNTED	44.301%	Swiss-Prot	moderate database homology
`Q9LV48`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK1	45.631%	Swiss-Prot	weak database homology
`Q9CAL8`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK13	46.181%	Swiss-Prot	weak database homology
`Q9ZUE0`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK12	45.833%	Swiss-Prot	weak database homology
`Q8RXC8`	Arabidopsis thaliana	Receptor-like cytosolic serine/threonine-protein kinase RBK2	44.337%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card