TkA07G395900 | RubberDandelionOmics

Gene overview

TkA07G395900

Reference: TK1151 Chr: Chr07 Coordinates: 99443324-99446932 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2674 bp · TkA07G395900|TK1151|cDNA

GAAGAATAAGACAAATAAAAAAGTTTGTAGTGGGTTGTGACTTGTGAGTGATTTTGGGGTCCCCTCTCTGTGCACAGCCGGAAAGCATGAAAGGCAAACCTAATAAAGGCAAAGCGAACGGCAACGGTTCAGTCACTGTTCATCTCATCGGCCGGGTCCCCAACGGCAACCAGTCACGGTTTTCTTCAGCTACATTTCCCTATGAGAACTCAATGCTCGCTGCTACATTTTCCTCCAAATCTCTAGCCAACAACTGCAAC...

CDS

Download CDS FASTA

2430 bp · TkA07G395900|TK1151|CDS

ATGAAAGGCAAACCTAATAAAGGCAAAGCGAACGGCAACGGTTCAGTCACTGTTCATCTCATCGGCCGGGTCCCCAACGGCAACCAGTCACGGTTTTCTTCAGCTACATTTCCCTATGAGAACTCAATGCTCGCTGCTACATTTTCCTCCAAATCTCTAGCCAACAACTGCAACAGTGAGCTTCTTCCAAAGATGAGTGAATCGGAGCTTGCCGGGGAGTACAGAGACCGGAATGTGGCCGGAGGTCGGACAGTTGTGGT...

Protein

Download Protein FASTA

809 aa · TkA07G395900|TK1151|PROTEIN

MKGKPNKGKANGNGSVTVHLIGRVPNGNQSRFSSATFPYENSMLAATFSSKSLANNCNSELLPKMSESELAGEYRDRNVAGGRTVVVGVKLDSQSRELLTWALVKQAQPGDRVVALHVLTNNEILDHEGKSSLLSLVNSFDSVLAVYEGFCNLKQVDLKLKICRGTSIRKIIVREAKSYNANEIIVGTARVHHTIRSSSSVAKYCAKKLKNCSIIAVSSGKIVFHRQSPSSTSGAKGSSDHHKNQIFSLIQRSLSLTPTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G395900`
TK1151 ID	TkA07G395900
OH-1004 ID	LXL04_030303
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 94.808 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G395900

Location Chr07:99443324-99446932 (+)

Description Similar to PERK1: Proline-rich receptor-like protein kinase PERK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16750`	Promotes cell proliferation in the gibberellic acid (GA) signaling pathway, acting downstream of RGA, and possibly through a negative regulation of two cyclin-dependent kinase inhibitors SIM and SMR1.	No verified direct reference in this release
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At1g10620`	Putative proline-rich receptor-like protein kinase PERK11.	No verified direct reference in this release
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030303 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G70460

ath:AT2G16750

ath:AT3G05140

ath:AT3G24550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.553

Rank 1 · TkA07G395900 · TK1151

Cytoplasm0.295

Rank 2 · TkA07G395900 · TK1151

Nucleus0.291

Rank 3 · TkA07G395900 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA07G395900 · TK1151

Plastid0.039

Rank 5 · TkA07G395900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00582Usp83-210 aa

PF00069Pkinase463-671 aa

PF07714PK_Tyr_Ser-Thr463-729 aa

PF03109ABC1473-510 aa

PF03109ABC1571-607 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G395900	`PF00582`	Usp	83	210	3.4e-07	31.6
TkA07G395900	`PF00069`	Pkinase	463	671	5.7e-43	147.9
TkA07G395900	`PF07714`	PK_Tyr_Ser-Thr	463	729	2e-41	142.7
TkA07G395900	`PF03109`	ABC1	473	510	0.0087	16.0
TkA07G395900	`PF03109`	ABC1	571	607	0.0087	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B5X4Z9`	Arabidopsis thaliana	sp\|B5X4Z9\|STU_ARATH Protein kinase STUNTED	44.100%	Swiss-Prot	Medium
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	45.300%	Swiss-Prot	Low
`Q9SGY7`	Arabidopsis thaliana	sp\|Q9SGY7\|PEK11_ARATH Putative proline-rich receptor-like protein kinase PERK11	42.900%	Swiss-Prot	Low
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	45.200%	Swiss-Prot	Low
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	45.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card