LXL04_024037 | RubberDandelionOmics

Gene overview

LXL04_024037

Reference: OH-1004 Chr: Chr05 Coordinates: 78373191-78374984 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1794 bp · LXL04_024037|LXL04_024037|OH1004|cDNA

ATGAACTGGTTCAGAGGTATTCTCTCCACCGTGTTGTTAATCACGTTTGTGCTTTTGTTATGTATTGGGTCGTCGTCGGTCTACGCGCAGGACGATGTCCAGTGTTTGCGAGGTTTTCAGAGGTCGTTCGATGGTCCAGGATCGGCGTCTTCAACGTGGAATTTTTCCAATACTACTAGAGGATTCATCTGCAGCTTCTATGGCGTCACCTGCTGGAACGATCAGGAGAATCGTGTAATTACGCTCACACTTCGTGACGC...

CDS

Download CDS FASTA

1794 bp · LXL04_024037|LXL04_024037|OH1004|CDS

ATGAACTGGTTCAGAGGTATTCTCTCCACCGTGTTGTTAATCACGTTTGTGCTTTTGTTATGTATTGGGTCGTCGTCGGTCTACGCGCAGGACGATGTCCAGTGTTTGCGAGGTTTTCAGAGGTCGTTCGATGGTCCAGGATCGGCGTCTTCAACGTGGAATTTTTCCAATACTACTAGAGGATTCATCTGCAGCTTCTATGGCGTCACCTGCTGGAACGATCAGGAGAATCGTGTAATTACGCTCACACTTCGTGACGC...

Protein

Download Protein FASTA

597 aa · LXL04_024037|LXL04_024037|OH1004|PROTEIN

MNWFRGILSTVLLITFVLLLCIGSSSVYAQDDVQCLRGFQRSFDGPGSASSTWNFSNTTRGFICSFYGVTCWNDQENRVITLTLRDAGLAGPVPSDLQSCRSLQNLDLSGNSLTGSIPSEICTWLPYLVSLDLSNNEFTGEIPASLGNCSFLNSLVLSGNKLSGSIPAQFSNLGRLNKFSVADNDLSGSIPSRLSNFDSSSFDGNNGLCGEPLTKCGSLSKKNLVIIIAAGVLGAVGSLLLGFGLWWWCSTKSMKKRRNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024037`
TK1151 ID	TkA06G185800
OH-1004 ID	LXL04_024037
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 99.101 / OH-1004 92.295 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024037

Location Chr05:78373191-78374984 (+)

Description Similar to BIR2: Inactive LRR receptor-like serine/threonine-protein kinase BIR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28450`	Pseudokinases lacking protein kinase activity and unable to bind ATP-analogs.	Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005
`At1g27190`	Probable inactive receptor kinase At1g27190.	No verified direct reference in this release
`At1g69990`	Probable LRR receptor-like serine/threonine-protein kinase At1g69990.	No verified direct reference in this release
`At5g48380`	Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380.	No verified direct reference in this release
`At1g55610`	Receptor with a serine/threonine-protein kinase activity.	BRL1, a leucine-rich repeat receptor-like protein kinase, is functionally redundant with BRI1 in regulating Arabidopsis brassinosteroid signaling.2004 · DOI: 10.1111/j.1365-313x.2004.02214.x BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024037 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G27190

ath:AT1G55610

ath:AT1G69990

ath:AT3G28450

ath:AT5G48380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.873

Rank 1 · LXL04_024037 · OH-1004

Endoplasmic reticulum0.079

Rank 2 · LXL04_024037 · OH-1004

Cytoplasm0.067

Rank 3 · LXL04_024037 · OH-1004

Nucleus0.049

Rank 4 · LXL04_024037 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_024037 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_230-72 aa

PF13855.13LRR_8101-162 aa

PF12799.14LRR_4102-136 aa

PF13855.13LRR_8126-186 aa

PF00069.32Pkinase314-564 aa

PF07714.24PK_Tyr_Ser-Thr316-565 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024037	`PF08263.18`	LRRNT_2	30	72	1e-06	29.6
LXL04_024037	`PF13855.13`	LRR_8	101	162	7.6e-09	35.9
LXL04_024037	`PF12799.14`	LRR_4	102	136	6.1e-08	33.4
LXL04_024037	`PF13855.13`	LRR_8	126	186	7.6e-09	35.9
LXL04_024037	`PF00069.32`	Pkinase	314	564	9.4e-20	71.8
LXL04_024037	`PF07714.24`	PK_Tyr_Ser-Thr	316	565	5.1e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSI9`	Arabidopsis thaliana	Inactive LRR receptor-like serine/threonine-protein kinase BIR2	57.025%	Swiss-Prot	strong database homology
`O04567`	Arabidopsis thaliana	Probable inactive receptor kinase At1g27190	54.817%	Swiss-Prot	strong database homology
`C0LGI5`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g69990	51.429%	Swiss-Prot	strong database homology
`Q9ASS4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380	41.608%	Swiss-Prot	moderate database homology
`Q9ZWC8`	Arabidopsis thaliana	Serine/threonine-protein kinase BRI1-like 1	35.465%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card