LXL04_022738 | RubberDandelionOmics

Gene overview

LXL04_022738

Reference: OH-1004 Chr: Chr05 Coordinates: 7235704-7239508 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2262 bp · LXL04_022738|LXL04_022738|OH1004|cDNA

ATGGTAACTAATTTGAACTCAACGACAAGCTGTTTTAACCTTGTGACGATTTACAGATTTCACACCGTGTATGTCTTCGCATGTGACTTTTGTCAGTTTCTCTGCAAAACATTTCAAATTCTCTCTCAAAAACCACACTCATTCCCTTCTTCACTTCATCTTCAAACTCCCAAAACCACAAATCCTTCCCTCAAAAACACCATGAAAACACTTCTTCTCGccgttcttcttcttttcgCTCACTCATTACAAACCCTAGC...

CDS

Download CDS FASTA

2262 bp · LXL04_022738|LXL04_022738|OH1004|CDS

ATGGTAACTAATTTGAACTCAACGACAAGCTGTTTTAACCTTGTGACGATTTACAGATTTCACACCGTGTATGTCTTCGCATGTGACTTTTGTCAGTTTCTCTGCAAAACATTTCAAATTCTCTCTCAAAAACCACACTCATTCCCTTCTTCACTTCATCTTCAAACTCCCAAAACCACAAATCCTTCCCTCAAAAACACCATGAAAACACTTCTTCTCGCCGTTCTTCTTCTTTTCGCTCACTCATTACAAACCCTAGC...

Protein

Download Protein FASTA

753 aa · LXL04_022738|LXL04_022738|OH1004|PROTEIN

MVTNLNSTTSCFNLVTIYRFHTVYVFACDFCQFLCKTFQILSQKPHSFPSSLHLQTPKTTNPSLKNTMKTLLLAVLLLFAHSLQTLAKTQETPTSELPALIKIKSILDPNGETLTSWSPNAASYCDGTFEGVACDELGKVMNISLQGKGLFGQIPPEIGQLKSLSGLYLHFNGLKGEIPKEIAELTQLTDLYLNVNNLSGEIPPELEKMENLRVLQLCYNQLTGSLPTQLGSLKKLNVLAVQYNQLTGAIPATLGNLGTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022738`
TK1151 ID	TkA06G456820
OH-1004 ID	LXL04_022738
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 99.203 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022738

Location Chr05:7235704-7239508 (-)

Description Similar to NIK2: Protein NSP-INTERACTING KINASE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25560`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At5g07280`	Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0283800`	May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022738 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G25560

ath:AT3G56100

ath:AT5G07280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.859

Rank 1 · LXL04_022738 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_022738 · OH-1004

Cytoplasm0.073

Rank 3 · LXL04_022738 · OH-1004

Nucleus0.057

Rank 4 · LXL04_022738 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_022738 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_295-135 aa

PF23598.2LRR_14151-265 aa

PF13855.13LRR_8211-270 aa

PF00069.32Pkinase478-738 aa

PF07714.24PK_Tyr_Ser-Thr480-743 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022738	`PF08263.18`	LRRNT_2	95	135	1.6e-06	29.0
LXL04_022738	`PF23598.2`	LRR_14	151	265	2.7e-12	46.8
LXL04_022738	`PF13855.13`	LRR_8	211	270	1.7e-11	44.4
LXL04_022738	`PF00069.32`	Pkinase	478	738	3.9e-25	89.5
LXL04_022738	`PF07714.24`	PK_Tyr_Ser-Thr	480	743	1.6e-36	126.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY65`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 6	28.186%	Swiss-Prot	weak database homology
`Q9LYN8`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase EMS1	29.335%	Swiss-Prot	weak database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	29.447%	Swiss-Prot	weak database homology
`C0LGP9`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase IMK3	27.840%	Swiss-Prot	weak database homology
`Q6K4T4`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	26.437%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card