RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G456820
Reference: TK1151 Chr: Chr06 Coordinates: 112901713-112905819 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2477 bp · TkA06G456820|TK1151|cDNA

TCAACGACAAGCTGTTTTAACCTTGTGACGATTTACAGATTTCACACCGTGTATGTCTTCGCATGTGACTTTTGTCAGTTTCTCTGCCAAACATTTCAAATTCTCTCTCAAAAACCACACTCATTCCCTTCTTCACTTCATCTTCAAACTCCCAAAACCACAAATCCTTCCCTCAAAAACACCATGAAAACACTTCTTCTCGTCGTTCTTCTTCTTTTCGCTCACTCATTACAAACCCTAGCTAAAACTCAAGAAACCCC...

CDS

Download CDS FASTA

2244 bp · TkA06G456820|TK1151|CDS

TCAACGACAAGCTGTTTTAACCTTGTGACGATTTACAGATTTCACACCGTGTATGTCTTCGCATGTGACTTTTGTCAGTTTCTCTGCCAAACATTTCAAATTCTCTCTCAAAAACCACACTCATTCCCTTCTTCACTTCATCTTCAAACTCCCAAAACCACAAATCCTTCCCTCAAAAACACCATGAAAACACTTCTTCTCGTCGTTCTTCTTCTTTTCGCTCACTCATTACAAACCCTAGCTAAAACTCAAGAAACCCC...

Protein

Download Protein FASTA

747 aa · TkA06G456820|TK1151|PROTEIN

STTSCFNLVTIYRFHTVYVFACDFCQFLCQTFQILSQKPHSFPSSLHLQTPKTTNPSLKNTMKTLLLVVLLLFAHSLQTLAKTQETPTSELPALIKIKSILDPNGETLTSWSPNTASYCDGTFEGVACDELGKVMNISLQGKGLFGQIPPEIGQLKSLSGLYLHFNGLNGEIPKEIGELTQLTDLYLNVNNLSGEIPPELEKMENLRVLQLCYNQLTGSLPTQLGSLKKLNVLAVQYNQLTGAIPATLGNLGTLERLDLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G456820
TK1151 IDTkA06G456820
OH-1004 IDLXL04_022738
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 99.203
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G456820
LocationChr06:112901713-112905819 (+)
DescriptionSimilar to NIK2: Protein NSP-INTERACTING KINASE 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g16670 Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress. No verified direct reference in this release
At3g25560 Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS. No verified direct reference in this release
At1g70530 Cysteine-rich receptor-like protein kinase 3. No verified direct reference in this release
At1g60800 Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS. No verified direct reference in this release
At5g63710 Probable LRR receptor-like serine/threonine-protein kinase At5g63710. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022738 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0010234 anther wall tapetum cell fate specification Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048638 regulation of developmental growth Biological Process
GO:1901653 cellular response to peptide Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT3G25560
ath:AT3G56100
ath:AT5G07280
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.859
Rank 1 · TkA06G456820 · TK1151
Endoplasmic reticulum0.088
Rank 2 · TkA06G456820 · TK1151
Cytoplasm0.073
Rank 3 · TkA06G456820 · TK1151
Nucleus0.056
Rank 4 · TkA06G456820 · TK1151
Lysosome / Vacuole0.023
Rank 5 · TkA06G456820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27852Opalin63-75 aa
PF08263LRRNT_289-129 aa
PF13855LRR_8136-192 aa
PF00560LRR_1137-155 aa
PF23598LRR_14146-260 aa
PF00560LRR_1157-179 aa
PF12799LRR_4157-196 aa
PF00560LRR_1182-203 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G456820PF27852Opalin63750.2812.0
TkA06G456820PF08263LRRNT_2891294.8e-0730.7
TkA06G456820PF13855LRR_81361925.4e-1142.8
TkA06G456820PF00560LRR_11371556.7e-1552.7
TkA06G456820PF23598LRR_141462601.5e-1247.7
TkA06G456820PF00560LRR_11571796.7e-1552.7
TkA06G456820PF12799LRR_41571961.3e-0629.1
TkA06G456820PF00560LRR_11822036.7e-1552.7
TkA06G456820PF00560LRR_12052276.7e-1552.7
TkA06G456820PF13855LRR_82052645.4e-1142.8
TkA06G456820PF12799LRR_42052411.3e-0629.1
TkA06G456820PF00560LRR_12302516.7e-1552.7
TkA06G456820PF12799LRR_42312681.3e-0629.1
TkA06G456820PF23598LRR_142432991.5e-1247.7
TkA06G456820PF00560LRR_12542706.7e-1552.7
TkA06G456820PF13855LRR_82762895.4e-1142.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93YN1Arabidopsis thalianasp|Q93YN1|CRPK1_ARATH Cold-responsive protein kinase 134.500%Swiss-ProtLow
Q8RY65Arabidopsis thalianasp|Q8RY65|CIK6_ARATH Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 630.800%Swiss-ProtMedium
Q9CAL2Arabidopsis thalianasp|Q9CAL2|CRK3_ARATH Cysteine-rich receptor-like protein kinase 333.200%Swiss-ProtLow
Q93ZS4Arabidopsis thalianasp|Q93ZS4|CIK1_ARATH Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 134.300%Swiss-ProtLow
Q8W4S5Arabidopsis thalianasp|Q8W4S5|Y5371_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g6371035.100%Swiss-ProtLow

JBrowse

View in Genome Browser