RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_021115
Reference: OH-1004 Chr: Chr04 Coordinates: 122007043-122009353 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

993 bp · LXL04_021115|LXL04_021115|OH1004|cDNA

ATGTTGCGTCTTCGAGTAACTACAAGTGTCTCATCGATCATTTTACTTTTTTGCCTTTTCAGCATTTGTGTGCATTGCAAAACCCTAAAAAGAGACGTGAAAGCTCTGAACGAAATCAAAGCATCTCTTGGATGGAGAGTGGTGTACGCATGGGTTGGAGATGATCCATGTGGAGATGGTGATTTACCAGCTTGGTCTGGTGTCACATGCTCCACACAAGGTGATTATAGAGTGGTTACTGAACTGGAAGTATATGCAGT...

CDS

Download CDS FASTA

993 bp · LXL04_021115|LXL04_021115|OH1004|CDS

ATGTTGCGTCTTCGAGTAACTACAAGTGTCTCATCGATCATTTTACTTTTTTGCCTTTTCAGCATTTGTGTGCATTGCAAAACCCTAAAAAGAGACGTGAAAGCTCTGAACGAAATCAAAGCATCTCTTGGATGGAGAGTGGTGTACGCATGGGTTGGAGATGATCCATGTGGAGATGGTGATTTACCAGCTTGGTCTGGTGTCACATGCTCCACACAAGGTGATTATAGAGTGGTTACTGAACTGGAAGTATATGCAGT...

Protein

Download Protein FASTA

330 aa · LXL04_021115|LXL04_021115|OH1004|PROTEIN

MLRLRVTTSVSSIILLFCLFSICVHCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKILNLRWNKLQDVIPQEIGELKKLTHLYLSFNNFKGEIPRELADLPELQHLHLHQNRLIGRIPPELGSLKNLRHLDVGDNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPTQLANLTNLEILHLSYNKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_021115
TK1151 IDTkA05G355220
OH-1004 IDLXL04_021115
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)94.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_021115
LocationChr04:122007043-122009353 (+)
DescriptionSimilar to RLP12: Receptor-like protein 12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g71400 Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
At3g11080 Receptor-like protein 35. No verified direct reference in this release
At1g17230 Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230. No verified direct reference in this release
At2g25790 Receptor with a serine/threonine-protein kinase activity (By similarity).
A novel pollen-pistil interaction conferring high-temperature tolerance during reproduction via CLE45 signaling.2013 · DOI: 10.1016/j.cub.2013.06.060
Arabidopsis MAKR5 is a positive effector of BAM3-dependent CLE45 signaling.2016 · DOI: 10.15252/embr.201642450

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0618700 Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).
Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635
Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021115 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G71400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.331
Rank 1 · LXL04_021115 · OH-1004
Extracellular0.250
Rank 2 · LXL04_021115 · OH-1004
Endoplasmic reticulum0.146
Rank 3 · LXL04_021115 · OH-1004
Cytoplasm0.106
Rank 4 · LXL04_021115 · OH-1004
Lysosome / Vacuole0.066
Rank 5 · LXL04_021115 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_893-137 aa
PF23598.2LRR_1497-204 aa
PF13855.13LRR_8103-161 aa
PF12799.14LRR_4103-139 aa
PF12799.14LRR_4125-165 aa
PF13855.13LRR_8126-185 aa
PF12799.14LRR_4149-189 aa
PF13855.13LRR_8171-209 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_021115PF13855.13LRR_8931371.5e-36124.7
LXL04_021115PF23598.2LRR_14972048.9e-1658.3
LXL04_021115PF13855.13LRR_81031611.5e-36124.7
LXL04_021115PF12799.14LRR_41031391.2e-2899.1
LXL04_021115PF12799.14LRR_41251651.2e-2899.1
LXL04_021115PF13855.13LRR_81261851.5e-36124.7
LXL04_021115PF12799.14LRR_41491891.2e-2899.1
LXL04_021115PF13855.13LRR_81712091.5e-36124.7
LXL04_021115PF12799.14LRR_41732161.2e-2899.1
LXL04_021115PF13855.13LRR_82242841.5e-36124.7
LXL04_021115PF12799.14LRR_42242581.2e-2899.1
LXL04_021115PF12799.14LRR_42482831.2e-2899.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C9H7Arabidopsis thalianaReceptor-like protein 1231.006%Swiss-Protmoderate database homology
Q9SRL7Arabidopsis thalianaReceptor-like protein 3534.982%Swiss-Protmoderate database homology
Q9SHI2Arabidopsis thalianaLeucine-rich repeat receptor-like serine/threonine-protein kinase At1g1723031.034%Swiss-Protmoderate database homology
O82318Arabidopsis thalianaLeucine-rich repeat receptor-like serine/threonine-protein kinase SKM137.872%Swiss-Protmoderate database homology
Q0JA29Oryza sativa subsp. japonicaLRR receptor-like serine/threonine-protein kinase FLS235.433%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser