LXL04_018428 | RubberDandelionOmics

Gene overview

LXL04_018428

Reference: OH-1004 Chr: Chr04 Coordinates: 12767621-12768762 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_018428|LXL04_018428|OH1004|cDNA

ATGTGGAGCTACGCCTTTCCGCAAAAGACCGAGGCTATTGTTGCTGAAAACCGAATATGGTCCGCTGAAGACCAGAATTGCGTAAAAGATGAGCTCTCATATGCGGCTGTAAGGGGGAGGGATGAGCCGCAAAAAGAGTTCAGCGAGGTGGTTTTAGCAAACAATCGCATCTTCATAGGTGTCTATGACGGTCACGGCAGGAATGAAGCTGCAGTGTACGTTGATCGACACTTGCTGCCTAATATCATAGGTATCATCAA...

CDS

Download CDS FASTA

993 bp · LXL04_018428|LXL04_018428|OH1004|CDS

ATGTGGAGCTACGCCTTTCCGCAAAAGACCGAGGCTATTGTTGCTGAAAACCGAATATGGTCCGCTGAAGACCAGAATTGCGTAAAAGATGAGCTCTCATATGCGGCTGTAAGGGGGAGGGATGAGCCGCAAAAAGAGTTCAGCGAGGTGGTTTTAGCAAACAATCGCATCTTCATAGGTGTCTATGACGGTCACGGCAGGAATGAAGCTGCAGTGTACGTTGATCGACACTTGCTGCCTAATATCATAGGTATCATCAA...

Protein

Download Protein FASTA

330 aa · LXL04_018428|LXL04_018428|OH1004|PROTEIN

MWSYAFPQKTEAIVAENRIWSAEDQNCVKDELSYAAVRGRDEPQKEFSEVVLANNRIFIGVYDGHGRNEAAVYVDRHLLPNIIGIINDRVPEEGELRSAFAKTETEFIACAREKVASSPSIDGAGASCLVAFVRDQKVIISHVGNCRAVVGVKKWGILKYIISSEPLTTENFEKWGILDEPICDPILCSVPSFSVRDIVPRDSFIVVASDVLLNILSNDEVVQFVYDNRGKNGIAKLLVEKAMRKAEEMREKRIKDMVGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018428`
TK1151 ID	TkA08G059480
OH-1004 ID	LXL04_018428
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018428

Location Chr04:12767621-12768762 (+)

Description Similar to Os04g0584300: Probable protein phosphatase 2C 43

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12620`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness (By similarity).	The Arabidopsis Protein Phosphatase PP2C38 Negatively Regulates the Central Immune Kinase BIK1.2016 · DOI: 10.1371/journal.ppat.1005811
`At3g55050`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0832400`	Probable protein phosphatase 2C 36.	No verified direct reference in this release
`UniProt: Q7XUC5`	Probable protein phosphatase 2C 43.	No verified direct reference in this release
`Os02g0685600`	Probable protein phosphatase 2C 25.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018428 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G12620

ath:AT3G55050

dosa:Os02g0685600

dosa:Os03g0832400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.430

Rank 1 · LXL04_018428 · OH-1004

Nucleus0.366

Rank 2 · LXL04_018428 · OH-1004

Cell membrane0.157

Rank 3 · LXL04_018428 · OH-1004

Endoplasmic reticulum0.087

Rank 4 · LXL04_018428 · OH-1004

Mitochondrion0.079

Rank 5 · LXL04_018428 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C54-152 aa

PF00481.27PP2C188-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018428	`PF00481.27`	PP2C	54	152	8.1e-16	59.2
LXL04_018428	`PF00481.27`	PP2C	188	246	8.1e-16	59.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHJ9`	Arabidopsis thaliana	Probable protein phosphatase 2C 38	27.160%	Swiss-Prot	weak database homology
`Q94CL8`	Arabidopsis thaliana	Probable protein phosphatase 2C 48	27.160%	Swiss-Prot	weak database homology
`Q7Y138`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 36	28.746%	Swiss-Prot	weak database homology
`Q7XUC5`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 43	27.760%	Swiss-Prot	weak database homology
`Q6ZHC8`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 25	29.022%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card