TkA08G059480 | RubberDandelionOmics

Gene overview

TkA08G059480

Reference: TK1151 Chr: Chr08 Coordinates: 15271105-15272244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · TkA08G059480|TK1151|cDNA

ATGTGGAGCTACGCCTTTCCGCAAAAGACTGAGGCTATTGTTGCTGAAAACCGAATATGGTCCGCTGAAGACCAGAATTGCGTAAAAGATGAGCTCTCATATGCGGCTGTGTCTGACGGTCACGGCGGGAATGAAGCTGCAGTGTACGTTGATCGACACTTGCTGCCTAATATCATAGGTATCATCAATGATCGCGTACCGGAAGAGAGAGAGCTTCGTTCGGCTTTTGCGAAAACCGAAACTGAATTCATTGCTTGTGC...

CDS

Download CDS FASTA

921 bp · TkA08G059480|TK1151|CDS

ATGTGGAGCTACGCCTTTCCGCAAAAGACTGAGGCTATTGTTGCTGAAAACCGAATATGGTCCGCTGAAGACCAGAATTGCGTAAAAGATGAGCTCTCATATGCGGCTGTGTCTGACGGTCACGGCGGGAATGAAGCTGCAGTGTACGTTGATCGACACTTGCTGCCTAATATCATAGGTATCATCAATGATCGCGTACCGGAAGAGAGAGAGCTTCGTTCGGCTTTTGCGAAAACCGAAACTGAATTCATTGCTTGTGC...

Protein

Download Protein FASTA

306 aa · TkA08G059480|TK1151|PROTEIN

MWSYAFPQKTEAIVAENRIWSAEDQNCVKDELSYAAVSDGHGGNEAAVYVDRHLLPNIIGIINDRVPEERELRSAFAKTETEFIACAREKVASSPSIDGAGASCLVAFVRDQKVIISHVGNCRAVVGVEKWGILKYIISSEPLTTENFEKWGILDEPICDPILCSVPSFLVRDIKPRDSFIVIASDVLLNILSNDEVVQFVYDNRGKNGIAKLLVEKAMRKAEEMREKRIKDMVGSVEVGRAYDDITVVVLLLNKGKKKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G059480`
TK1151 ID	TkA08G059480
OH-1004 ID	LXL04_018428
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G059480

Location Chr08:15271105-15272244 (+)

Description Similar to Os04g0584300: Probable protein phosphatase 2C 43

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67820`	Probable protein phosphatase 2C 14.	No verified direct reference in this release
`At3g12620`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness (By similarity).	The Arabidopsis Protein Phosphatase PP2C38 Negatively Regulates the Central Immune Kinase BIK1.2016 · DOI: 10.1371/journal.ppat.1005811
`At2g34740`	Probable protein phosphatase 2C 28.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0207400`	Probable protein phosphatase 2C 29.	No verified direct reference in this release
`Os02g0685600`	Probable protein phosphatase 2C 25.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018428 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G12620

ath:AT3G55050

dosa:Os02g0685600

dosa:Os03g0832400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.455

Rank 1 · TkA08G059480 · TK1151

Nucleus0.375

Rank 2 · TkA08G059480 · TK1151

Cell membrane0.128

Rank 3 · TkA08G059480 · TK1151

Endoplasmic reticulum0.087

Rank 4 · TkA08G059480 · TK1151

Mitochondrion0.076

Rank 5 · TkA08G059480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13672PP2C_227-126 aa

PF00481PP2C28-127 aa

PF00481PP2C164-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G059480	`PF13672`	PP2C_2	27	126	0.051	13.9
TkA08G059480	`PF00481`	PP2C	28	127	1.9e-16	61.3
TkA08G059480	`PF00481`	PP2C	164	222	1.9e-16	61.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXE4`	Arabidopsis thaliana	sp\|Q9FXE4\|P2C14_ARATH Probable protein phosphatase 2C 14	24.900%	Swiss-Prot	Low
`Q9LHJ9`	Arabidopsis thaliana	sp\|Q9LHJ9\|P2C38_ARATH Probable protein phosphatase 2C 38	32.700%	Swiss-Prot	Low
`O64583`	Arabidopsis thaliana	sp\|O64583\|P2C28_ARATH Probable protein phosphatase 2C 28	23.200%	Swiss-Prot	Low
`Q8H063`	Oryza sativa subsp. japonica	sp\|Q8H063\|P2C29_ORYSJ Probable protein phosphatase 2C 29	26.600%	Swiss-Prot	Low
`Q6ZHC8`	Oryza sativa subsp. japonica	sp\|Q6ZHC8\|P2C25_ORYSJ Probable protein phosphatase 2C 25	40.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card