LXL04_014642 | RubberDandelionOmics

Gene overview

LXL04_014642

Reference: OH-1004 Chr: Chr03 Coordinates: 54275456-54280273 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1698 bp · LXL04_014642|LXL04_014642|OH1004|cDNA

ATGGCCGATACCATTAGTCATCCCCATAATTATCAGCTCACCCTCTCCTCTTTCCTGCATTCATTTTCACCCAAAATCCCAATTCACAAAATTTCATACCCTAATCCACAGACGCTCGATACAGACCTATTAGATACAAAAATAACTATGAATCATCAATCTATGAACATCCGAATTCAGGCACCATGCCCGCCTTCTCCTTCTTCTGCATTTCCTCCGAGGTTCCATCACAAAACTCCTACAATATTGCCACGTGCAAT...

CDS

Download CDS FASTA

1698 bp · LXL04_014642|LXL04_014642|OH1004|CDS

ATGGCCGATACCATTAGTCATCCCCATAATTATCAGCTCACCCTCTCCTCTTTCCTGCATTCATTTTCACCCAAAATCCCAATTCACAAAATTTCATACCCTAATCCACAGACGCTCGATACAGACCTATTAGATACAAAAATAACTATGAATCATCAATCTATGAACATCCGAATTCAGGCACCATGCCCGCCTTCTCCTTCTTCTGCATTTCCTCCGAGGTTCCATCACAAAACTCCTACAATATTGCCACGTGCAAT...

Protein

Download Protein FASTA

565 aa · LXL04_014642|LXL04_014642|OH1004|PROTEIN

MADTISHPHNYQLTLSSFLHSFSPKIPIHKISYPNPQTLDTDLLDTKITMNHQSMNIRIQAPCPPSPSSAFPPRFHHKTPTILPRAICSSDVASHVVAQMESSSDTITTWKHKRTFGCLQKQSLLKQPLNKDLKPLKALLTSTTQDTSSSLANGGKIGVLLLNLGGPETLDDVQPFLFNLFADPDIIRLPRLFRFLQKPLAQFISVARAPKSKEGYAAIGGGKALYEKNVPAEVYVGMRYWHPFTEEAIEQIKKDGVNKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014642`
TK1151 ID	TkA02G406860
OH-1004 ID	LXL04_014642
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 99.429 / OH-1004 89.735 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014642

Location Chr03:54275456-54280273 (+)

Description Similar to HEMH: Ferrochelatase-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30390`	Catalyzes the last step of heme biosynthesis by inserting ferrous iron into protoporphyrin IX to produce protoheme.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y3Q5`	Catalyzes the ferrous insertion into protoporphyrin IX.	No verified direct reference in this release
`Os05g0361200`	Catalyzes the ferrous insertion into protoporphyrin IX.	No verified direct reference in this release
`Os09g0297000`	Catalyzes the ferrous insertion into protoporphyrin IX.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014642 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006779 porphyrin-containing compound biosynthetic process Biological Process

GO:0006783 heme biosynthetic process Biological Process

GO:0033014 tetrapyrrole biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0055035 plastid thylakoid membrane Cellular Component

GO:0004325 ferrochelatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G30390

dosa:Os05g0361200

dosa:Os09g0297000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · LXL04_014642 · OH-1004

Mitochondrion0.037

Rank 2 · LXL04_014642 · OH-1004

Cytoplasm0.024

Rank 3 · LXL04_014642 · OH-1004

Nucleus0.018

Rank 4 · LXL04_014642 · OH-1004

Peroxisome0.016

Rank 5 · LXL04_014642 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00762.25Ferrochelatase156-465 aa

PF31213.1HliA512-545 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014642	`PF00762.25`	Ferrochelatase	156	465	3e-99	332.7
LXL04_014642	`PF31213.1`	HliA	512	545	2.8e-07	31.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04921`	Arabidopsis thaliana	Ferrochelatase-2, chloroplastic	82.609%	Swiss-Prot	strong database homology
`A2Y3Q5`	Oryza sativa subsp. indica	Ferrochelatase-2, chloroplastic	80.388%	Swiss-Prot	strong database homology
`Q0DIV0`	Oryza sativa subsp. japonica	Ferrochelatase-2, chloroplastic	80.388%	Swiss-Prot	strong database homology
`Q69TB1`	Oryza sativa subsp. japonica	Ferrochelatase-1, chloroplastic	65.013%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card