LXL04_014598 | RubberDandelionOmics

Gene overview

LXL04_014598

Reference: OH-1004 Chr: Chr03 Coordinates: 53453919-53454350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_014598|LXL04_014598|OH1004|cDNA

ATGTCTTCTCTTAACTACAACGACTTGCATCGCCTTTTTAAGAAACTTGACCAAAACGGAGATGGCCTGGTGACCCCCAATGAGCTCCAATGGCTTCTTGACACCATGAAAATCTCTTCAAGCGTTGATGAGCTACAATGCTTAACTGGGAAAACCAGTCTTAATTTTACCGAGTTTCTGGACTTTTATACAACCACAATAGAAGGAAAGGAGACTGAGAAAGATTTAGAGGGCGATCTTTTCAAGGCTTTTGAGGTGTT...

CDS

Download CDS FASTA

432 bp · LXL04_014598|LXL04_014598|OH1004|CDS

ATGTCTTCTCTTAACTACAACGACTTGCATCGCCTTTTTAAGAAACTTGACCAAAACGGAGATGGCCTGGTGACCCCCAATGAGCTCCAATGGCTTCTTGACACCATGAAAATCTCTTCAAGCGTTGATGAGCTACAATGCTTAACTGGGAAAACCAGTCTTAATTTTACCGAGTTTCTGGACTTTTATACAACCACAATAGAAGGAAAGGAGACTGAGAAAGATTTAGAGGGCGATCTTTTCAAGGCTTTTGAGGTGTT...

Protein

Download Protein FASTA

143 aa · LXL04_014598|LXL04_014598|OH1004|PROTEIN

MSSLNYNDLHRLFKKLDQNGDGLVTPNELQWLLDTMKISSSVDELQCLTGKTSLNFTEFLDFYTTTIEGKETEKDLEGDLFKAFEVFDRNRDGLICDEELQEALSNLGLWDDKGDMDVKSMIKAYDANSDGFLDFQEFKKMMA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014598`
TK1151 ID	TkA02G409280
OH-1004 ID	LXL04_014598
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014598

Location Chr03:53453919-53454350 (+)

Description Similar to CML44: Probable calcium-binding protein CML44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21550`	Potential calcium sensor.	No verified direct reference in this release
`At4g20780`	Probable calcium sensor that binds calcium in vitro.	Calmodulin-like proteins from Arabidopsis and tomato are involved in host defense against Pseudomonas syringae pv. tomato.2005 · DOI: 10.1007/s11103-005-8395-x The calmodulin-related calcium sensor CML42 plays a role in trichome branching.2009 · DOI: 10.1074/jbc.m109.056770
`At4g12860`	Potential calcium sensor that is required for pollen tube attraction for ovule fertilization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0492800`	Potential calcium sensor.	No verified direct reference in this release
`Os03g0331700`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014598 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G21550

ath:AT4G20780

dosa:Os03g0331700

dosa:Os04g0492800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.655

Rank 1 · LXL04_014598 · OH-1004

Nucleus0.262

Rank 2 · LXL04_014598 · OH-1004

Endoplasmic reticulum0.093

Rank 3 · LXL04_014598 · OH-1004

Mitochondrion0.071

Rank 4 · LXL04_014598 · OH-1004

Peroxisome0.071

Rank 5 · LXL04_014598 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_77-64 aa

PF13405.13EF-hand_68-34 aa

PF00036.39EF-hand_19-33 aa

PF13202.13EF-hand_512-30 aa

PF23564.2EF-hand_FSTL159-142 aa

PF13499.13EF-hand_779-142 aa

PF00036.39EF-hand_180-106 aa

PF13405.13EF-hand_680-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014598	`PF13499.13`	EF-hand_7	7	64	3.8e-20	72.7
LXL04_014598	`PF13405.13`	EF-hand_6	8	34	1.6e-19	68.4
LXL04_014598	`PF00036.39`	EF-hand_1	9	33	1.3e-22	78.3
LXL04_014598	`PF13202.13`	EF-hand_5	12	30	9.7e-20	69.8
LXL04_014598	`PF23564.2`	EF-hand_FSTL1	59	142	5.6e-09	37.1
LXL04_014598	`PF13499.13`	EF-hand_7	79	142	3.8e-20	72.7
LXL04_014598	`PF00036.39`	EF-hand_1	80	106	1.3e-22	78.3
LXL04_014598	`PF13405.13`	EF-hand_6	80	108	1.6e-19	68.4
LXL04_014598	`PF13202.13`	EF-hand_5	82	102	9.7e-20	69.8
LXL04_014598	`PF00036.39`	EF-hand_1	117	143	1.3e-22	78.3
LXL04_014598	`PF13405.13`	EF-hand_6	119	142	1.6e-19	68.4
LXL04_014598	`PF13202.13`	EF-hand_5	120	142	9.7e-20	69.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPK5`	Arabidopsis thaliana	Probable calcium-binding protein CML44	42.953%	Swiss-Prot	moderate database homology
`Q9SVG9`	Arabidopsis thaliana	Calcium-binding protein CML42	39.506%	Swiss-Prot	moderate database homology
`Q9SU00`	Arabidopsis thaliana	Calmodulin-like protein 2	34.752%	Swiss-Prot	moderate database homology
`Q0JC44`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML22	34.000%	Swiss-Prot	moderate database homology
`Q10LX4`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML27	35.443%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card