TkA02G409280 | RubberDandelionOmics

Gene overview

TkA02G409280

Reference: TK1151 Chr: Chr02 Coordinates: 104103774-104104205 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA02G409280|TK1151|cDNA

ATGTCTTCTCTTAACTACAACGACTTGCATCGCCTTTTTAAGAAACTTGACCAAAACGGAGATGGCCTGGTGACCCCCAATGAGCTCCAATGGCTTCTTGACACCATGAAAATCTCTTCAAGCGTTGATGAGCTACAATGCTTAACTGGGAAAACCAGTCTTAATTTTACCGAGTTTCTGGACTTTTATACAACCACAATAGAAGGAAAGGAGACTGAGAAAGATTTAGAGGGCGATCTTTTCAAGGCTTTTGAGGTGTT...

CDS

Download CDS FASTA

432 bp · TkA02G409280|TK1151|CDS

ATGTCTTCTCTTAACTACAACGACTTGCATCGCCTTTTTAAGAAACTTGACCAAAACGGAGATGGCCTGGTGACCCCCAATGAGCTCCAATGGCTTCTTGACACCATGAAAATCTCTTCAAGCGTTGATGAGCTACAATGCTTAACTGGGAAAACCAGTCTTAATTTTACCGAGTTTCTGGACTTTTATACAACCACAATAGAAGGAAAGGAGACTGAGAAAGATTTAGAGGGCGATCTTTTCAAGGCTTTTGAGGTGTT...

Protein

Download Protein FASTA

143 aa · TkA02G409280|TK1151|PROTEIN

MSSLNYNDLHRLFKKLDQNGDGLVTPNELQWLLDTMKISSSVDELQCLTGKTSLNFTEFLDFYTTTIEGKETEKDLEGDLFKAFEVFDRNRDGLICDEELQEALSNLGLWDDKGDMDVKSMIKAYDANSDGFLDFQEFKKMMA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G409280`
TK1151 ID	TkA02G409280
OH-1004 ID	LXL04_014598
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G409280

Location Chr02:104103774-104104205 (-)

Description Similar to CML44: Probable calcium-binding protein CML44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21550`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0312600`	Potential calcium sensor.	No verified direct reference in this release
`Os08g0144100`	Potential calcium sensor.	No verified direct reference in this release
`Os07g0681400`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014598 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G21550

ath:AT4G20780

dosa:Os03g0331700

dosa:Os04g0492800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.655

Rank 1 · TkA02G409280 · TK1151

Nucleus0.262

Rank 2 · TkA02G409280 · TK1151

Endoplasmic reticulum0.093

Rank 3 · TkA02G409280 · TK1151

Mitochondrion0.071

Rank 4 · TkA02G409280 · TK1151

Peroxisome0.071

Rank 5 · TkA02G409280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499EF-hand_77-64 aa

PF23564EF-hand_FSTL17-44 aa

PF13833EF-hand_87-28 aa

PF13405EF-hand_68-34 aa

PF24548EF_EFCAB10_C8-40 aa

PF00036EF-hand_19-33 aa

PF10591SPARC_Ca_bdg9-33 aa

PF30624EF_SSP12010-28 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G409280	`PF13499`	EF-hand_7	7	64	3.8e-20	72.7
TkA02G409280	`PF23564`	EF-hand_FSTL1	7	44	5.6e-09	37.1
TkA02G409280	`PF13833`	EF-hand_8	7	28	5.3e-06	26.8
TkA02G409280	`PF13405`	EF-hand_6	8	34	1.6e-19	68.4
TkA02G409280	`PF24548`	EF_EFCAB10_C	8	40	0.00064	20.0
TkA02G409280	`PF00036`	EF-hand_1	9	33	1.3e-22	78.3
TkA02G409280	`PF10591`	SPARC_Ca_bdg	9	33	0.0017	19.3
TkA02G409280	`PF30624`	EF_SSP120	10	28	0.047	15.1
TkA02G409280	`PF13202`	EF-hand_5	12	30	9.7e-20	69.8
TkA02G409280	`PF14658`	EF-hand_9	12	25	0.0081	17.3
TkA02G409280	`PF21008`	AIF-1	12	50	0.035	15.1
TkA02G409280	`PF00404`	Dockerin_1	14	32	0.13	13.2
TkA02G409280	`PF29176`	Allatotropin-like_C	16	29	2e-05	24.8
TkA02G409280	`PF05042`	Caleosin	16	29	0.06	14.0
TkA02G409280	`PF13202`	EF-hand_5	41	46	9.7e-20	69.8
TkA02G409280	`PF00036`	EF-hand_1	53	64	1.3e-22	78.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPK5`	Arabidopsis thaliana	sp\|Q9LPK5\|CML44_ARATH Probable calcium-binding protein CML44	43.000%	Swiss-Prot	Medium
`Q0DJ94`	Oryza sativa subsp. japonica	sp\|Q0DJ94\|CML21_ORYSJ Probable calcium-binding protein CML21	34.000%	Swiss-Prot	Medium
`Q84UL5`	Oryza sativa subsp. japonica	sp\|Q84UL5\|CML32_ORYSJ Probable calcium-binding protein CML32	34.400%	Swiss-Prot	Medium
`Q7XHW4`	Oryza sativa subsp. japonica	sp\|Q7XHW4\|CML24_ORYSJ Probable calcium-binding protein CML24	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card