Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2769 bp · LXL04_009794|LXL04_009794|OH1004|cDNA
CAATTCAAATCTAACTAAACACACACGCGGAACACCATTTTTGATTCCCGCTCAAAACGTCCCGCTTATAAAACCCTCGCGACCATTCTCTCTCTACACGCTCTCTTTCGACATAGTCTCTTCGCCGCACTCTTCCGTCATTTTCTCTCTCATCGCCGCCAGAAAATGCCGAGGGCAAAGAGAAGGTCTTCATCTGCCTCCAAGGACGATACATTGGTTTCTTCGGAGAAACGCCCAAAAatagaagaagaaaagaaggg...
2604 bp · LXL04_009794|LXL04_009794|OH1004|CDS
ATGCCGAGGGCAAAGAGAAGGTCTTCATCTGCCTCCAAGGACGATACATTGGTTTCTTCGGAGAAACGCCCAAAAATAGAAGAAGAAAAGAAGGGAGAGGTAGAAGAAGCTTCTGCGGTCCCCGATCCGGTTTCTCTGGTGAAAAGCTCCGGCGAAAAGTCTGAGAAGCCTAAGGCCAAGGCGAAGGCAAATGTGAAGAATGAAGAAGATGATGCGGAGGAGAGTCGATTTGTTGGAGATCCAGTCCCTGCTGACGAAGC...
Protein
Download Protein FASTA867 aa · LXL04_009794|LXL04_009794|OH1004|PROTEIN
MPRAKRRSSSASKDDTLVSSEKRPKIEEEKKGEVEEASAVPDPVSLVKSSGEKSEKPKAKAKANVKNEEDDAEESRFVGDPVPADEARQRWPLRYLPKNKAGKTQSLETTNGVQPPKDLMQAKRHFTEALVDGNVLFKLGDDGYVQAEEGEDSYICKVVEMFEGVDGTSYFSAQWFYRAKDTIIQACSNLIDDKRIFLSEIKDDNPLDCLLQKLKIVRVPLDADVSEKRAKLGDGDYYYDMSYLVPYSTYQNLPIEVEGD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009794 |
|---|---|
| TK1151 ID | TkA03G472030 |
| OH-1004 ID | LXL04_009794 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 90.840 / OH-1004 96.078Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009794 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:133483776-133489055 (-) | ||||||||||||
| Description | Similar to CMT3: DNA (cytosine-5)-methyltransferase CMT3 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0010069 zygote asymmetric cytokinesis in embryo sac Biological Process GO:0032259 methylation Biological Process GO:0044027 negative regulation of gene expression via chromosomal CpG island methylation Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:0141010 transposable element silencing by siRNA-mediated DNA methylation Biological Process GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0003682 chromatin binding Molecular Function GO:0003886 DNA (cytosine-5-)-methyltransferase activity Molecular Function GO:0031625 ubiquitin protein ligase binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G69770 dosa:Os10g0104900 zma:542060 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01426.25BAH137-243 aaPF00385.31Chromo404-457 aaPF00145.24DNA_methylase468-829 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009794 | PF01426.25 | BAH | 137 | 243 | 5.1e-10 | 40.0 |
| LXL04_009794 | PF00385.31 | Chromo | 404 | 457 | 1.7e-11 | 44.6 |
| LXL04_009794 | PF00145.24 | DNA_methylase | 468 | 829 | 8.2e-39 | 134.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.