LXL04_009476 | RubberDandelionOmics

Gene overview

LXL04_009476

Reference: OH-1004 Chr: Chr02 Coordinates: 127124662-127128691 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_009476|LXL04_009476|OH1004|cDNA

atgaaaatgtcGAGTTCAGTTGTAGCGTACAGCTTCCGCCATATCCCACCTTTAAAGCAGCGCTCAATCCAGTACTTCTCTCATCAACGTCTTCTCCGCCGTCGTCCGCTCCGCTCACCGTGCACCGTTCCCGTCGCTACCTCTACATCGTCTTGCAGTCTTCTAAATTCTGCGTCTTTCACGGGCAATTCATTGTTTCGTAGGATGGAGCGATACTGGGCGGCAAGTAGCGTGAACAAGAATCAAGGCATGGTGGAGCA...

CDS

Download CDS FASTA

1002 bp · LXL04_009476|LXL04_009476|OH1004|CDS

ATGAAAATGTCGAGTTCAGTTGTAGCGTACAGCTTCCGCCATATCCCACCTTTAAAGCAGCGCTCAATCCAGTACTTCTCTCATCAACGTCTTCTCCGCCGTCGTCCGCTCCGCTCACCGTGCACCGTTCCCGTCGCTACCTCTACATCGTCTTGCAGTCTTCTAAATTCTGCGTCTTTCACGGGCAATTCATTGTTTCGTAGGATGGAGCGATACTGGGCGGCAAGTAGCGTGAACAAGAATCAAGGCATGGTGGAGCA...

Protein

Download Protein FASTA

333 aa · LXL04_009476|LXL04_009476|OH1004|PROTEIN

MKMSSSVVAYSFRHIPPLKQRSIQYFSHQRLLRRRPLRSPCTVPVATSTSSCSLLNSASFTGNSLFRRMERYWAASSVNKNQGMVEHLQRYGVIHSKKVAEVMQTIDRALFVPDGFSAYEDSPMQIGFNATISAPHMHATCLQLLEKNLQPGMHALDVGSGTGYLTACFALMVGPQGRAVGVDHIPELVTTSITNIEKSAAGQLLKDGSLALHVADGREGWVEFAPYDAIHVGAAAPEIPQPLIDQLKPGGRLVIPVGNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009476`
TK1151 ID	TkA03G441230
OH-1004 ID	LXL04_009476
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 93.093 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009476

Location Chr02:127124662-127128691 (+)

Description Similar to PIMT1: Protein-L-isoaspartate O-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50240`	Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues.	A second protein L-isoaspartyl methyltransferase gene in Arabidopsis produces two transcripts whose products are sequestered in the nucleus.2004 · DOI: 10.1104/pp.104.046094 Arabidopsis Protein Repair L-Isoaspartyl Methyltransferases: Predominant Activities at Lethal Temperatures.2006 · DOI: 10.1111/j.1399-3054.2006.00772.x
`At3g48330`	Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues.	A second protein L-isoaspartyl methyltransferase gene in Arabidopsis produces two transcripts whose products are sequestered in the nucleus.2004 · DOI: 10.1104/pp.104.046094 Protein repair L-isoaspartyl methyltransferase 1 is involved in both seed longevity and germination vigor in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058479 Arabidopsis Protein Repair L-Isoaspartyl Methyltransferases: Predominant Activities at Lethal Temperatures.2006 · DOI: 10.1111/j.1399-3054.2006.00772.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009476 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006479 protein methylation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009845 seed germination Biological Process

GO:0030091 protein repair Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G48330

ath:AT5G50240

gga:428607

ssc:100502562

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.391

Rank 1 · LXL04_009476 · OH-1004

Mitochondrion0.296

Rank 2 · LXL04_009476 · OH-1004

Cytoplasm0.245

Rank 3 · LXL04_009476 · OH-1004

Nucleus0.117

Rank 4 · LXL04_009476 · OH-1004

Peroxisome0.100

Rank 5 · LXL04_009476 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01135.26PCMT80-289 aa

PF13847.13Methyltransf_31150-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009476	`PF01135.26`	PCMT	80	289	6.2e-81	271.9
LXL04_009476	`PF13847.13`	Methyltransf_31	150	202	1.5e-07	32.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q64J17`	Arabidopsis thaliana	Protein-L-isoaspartate O-methyltransferase 2	69.658%	Swiss-Prot	strong database homology
`Q42539`	Arabidopsis thaliana	Protein-L-isoaspartate O-methyltransferase 1	70.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card