Gene Card
Gene overview
cDNA / CDS / Protein Sequences
399 bp · LXL04_002329|LXL04_002329|OH1004|cDNA
ATGATGGATCCCGGAACCGGCCCCACCACAGCTACCCCCAGCACCGACGTTCCCCCGTCAGTGGGTACGCTGCATTCAACGGACACACCTGCAGCAGCCTTGCAACGGTGGGTTTCTGTGGTCTCGTACGCTCTCGGCATTTACATCCTTAATCTCCTCATAGGGTTTATTTCTCCTCAGGTCGATCCGGAATTCCAAGACCTTTCCGATGGCCCTACTCTACCCTCTTGGAACTCCGATGAGTTCCGCCCCTGTGTTCG...
399 bp · LXL04_002329|LXL04_002329|OH1004|CDS
ATGATGGATCCCGGAACCGGCCCCACCACAGCTACCCCCAGCACCGACGTTCCCCCGTCAGTGGGTACGCTGCATTCAACGGACACACCTGCAGCAGCCTTGCAACGGTGGGTTTCTGTGGTCTCGTACGCTCTCGGCATTTACATCCTTAATCTCCTCATAGGGTTTATTTCTCCTCAGGTCGATCCGGAATTCCAAGACCTTTCCGATGGCCCTACTCTACCCTCTTGGAACTCCGATGAGTTCCGCCCCTGTGTTCG...
Protein
Download Protein FASTA132 aa · LXL04_002329|LXL04_002329|OH1004|PROTEIN
MMDPGTGPTTATPSTDVPPSVGTLHSTDTPAAALQRWVSVVSYALGIYILNLLIGFISPQVDPEFQDLSDGPTLPSWNSDEFRPCVRRLLEFKFWITNELRKQQPNNTRKWIAIGTCLQHNLRLAMGNFLFA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002329 |
|---|---|
| TK1151 ID | TkAUNG014060 |
| OH-1004 ID | LXL04_002329 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 52.486 / OH-1004 71.970Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002329 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:46304760-46305287 (-) | |||||||||
| Description | Similar to RER1A: Protein RER1A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006621 protein retention in ER lumen Biological Process GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process GO:0007528 neuromuscular junction development Biological Process GO:0035437 maintenance of protein localization in endoplasmic reticulum Biological Process GO:0071340 skeletal muscle acetylcholine-gated channel clustering Biological Process GO:1903078 positive regulation of protein localization to plasma membrane Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005801 cis-Golgi network Cellular Component GO:0005886 plasma membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G21600 ath:AT4G39220 bta:100125922 gga:419397 rno:298675 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03248.19Rer139-97 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002329 | PF03248.19 | Rer1 | 39 | 97 | 6.5e-20 | 72.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.