Gene Card
Gene overview
cDNA / CDS / Protein Sequences
843 bp · LXL04_000940|LXL04_000940|OH1004|cDNA
ATGGAGAAGAGAACTCCATTTTTTCTTACAAGATTGTTGAGAAGAAGCCCGCAGAATTCTGAATCTAGTGAACAAAGTGGTTGGGAGAACATAGAAGAAGAAAACACCCGGTTTGGTGGTTGGGGATCATCCCCTGTTTCCACTAGTTCTGGAGCAATCGCCAATGGTTGGGCAGATGAACCACctaaacacgagtataatggATGGGGGTCTAGCTACCCAGATGGTAAATCTACAACCCCTGAAACAAGTACCAATGG...
843 bp · LXL04_000940|LXL04_000940|OH1004|CDS
ATGGAGAAGAGAACTCCATTTTTTCTTACAAGATTGTTGAGAAGAAGCCCGCAGAATTCTGAATCTAGTGAACAAAGTGGTTGGGAGAACATAGAAGAAGAAAACACCCGGTTTGGTGGTTGGGGATCATCCCCTGTTTCCACTAGTTCTGGAGCAATCGCCAATGGTTGGGCAGATGAACCACCTAAACACGAGTATAATGGATGGGGGTCTAGCTACCCAGATGGTAAATCTACAACCCCTGAAACAAGTACCAATGG...
Protein
Download Protein FASTA280 aa · LXL04_000940|LXL04_000940|OH1004|PROTEIN
MEKRTPFFLTRLLRRSPQNSESSEQSGWENIEEENTRFGGWGSSPVSTSSGAIANGWADEPPKHEYNGWGSSYPDGKSTTPETSTNGWLTDDNQLAESEPEFVNGESFPCPPVPSAPPLPDNDLNDHDASNTFNHLGFDFVKKDVVSMDQSKNGDGSCVVCWEAPVDGACVPCGHMHLIIWFAVGGCYKDNAGDEEEKLSTEMQLKSQKNFDATAIRDRSLPGFGVGVAFIDESEIHPIITSTDFNQSTKNLLLVPISNI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000940 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000940 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:16995590-16998198 (+) | ||||||||||||
| Description | Similar to XBOS34: Probable E3 ubiquitin-protein ligase XBOS34 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0002143 tRNA wobble position uridine thiolation Biological Process GO:0010311 lateral root formation Biological Process GO:0016567 protein ubiquitination Biological Process GO:0032447 protein urmylation Biological Process GO:0034227 tRNA thio-modification Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0000049 tRNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016779 nucleotidyltransferase activity Molecular Function GO:0016783 sulfurtransferase activity Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT4G35910 dosa:Os07g0446100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.