TkA02G478780 | RubberDandelionOmics

Gene overview

TkA02G478780

Reference: TK1151 Chr: Chr02 Coordinates: 122186953-122188413 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · TkA02G478780|TK1151|cDNA

AATTTAGTTACAGAGCAACTGTGTAAGTTATCTTGGATTACGGCACTTCCGAGTGATATTATGGACGAATCAAATTCTCAGCAATGGAAAAAGGCGATGTTGTTTTCAGTTCTTCTCTAGCACTTTCCACGAATCCTATGATTGATTTGACCCAAAGGGTGTTAGCTGAGTTTATTGGAATGTATATTATTATGTTTGCCGGTTGTGGGTCGATAGCAGTGAATAAACTTTACGGTGGCACAGTCACTTTTCCTGGAATA...

CDS

Download CDS FASTA

357 bp · TkA02G478780|TK1151|CDS

ATGGAAAAAGGCGATGTTGTTTTCAGTTCTTCTCTAGCACTTTCCACGAATCCTATGATTGATTTGACCCAAAGGGTGTTAGCTGAGTTTATTGGAATGTATATTATTATGTTTGCCGGTTGTGGGTCGATAGCAGTGAATAAACTTTACGGTGGCACAGTCACTTTTCCTGGAATATGTCTTGTATGGGGCCTAATCGTAATGGCTATGATTTACTCTCTTGGTCACGTATCGGCCCACTTTAATCCTGTTGTGACCAT...

Protein

Download Protein FASTA

118 aa · TkA02G478780|TK1151|PROTEIN

MEKGDVVFSSSLALSTNPMIDLTQRVLAEFIGMYIIMFAGCGSIAVNKLYGGTVTFPGICLVWGLIVMAMIYSLGHVSAHFNPVVTIALHLGFVPFKEVFYYVVSQILGAILGAEQWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G478780`
TK1151 ID	TkA02G478780
OH-1004 ID	LXL04_013679
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.600
Protein coverage (%)	TK1151 95.763 / OH-1004 44.882 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G478780

Location Chr02:122186953-122188413 (-)

Description Similar to Probable aquaporin NIP-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37820`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At5g37810`	Potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At4g18910`	Water channel probably required to promote glycerol permeability and water transport across cell membranes.	Functional identification of the glycerol permease activity of Arabidopsis thaliana NLM1 and NLM2 proteins by heterologous expression in Saccharomyces cerevisiae.2000 · DOI: 10.1016/s0014-5793(00)02027-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0205000`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013679 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015700 arsenite transport Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015105 arsenite transmembrane transporter activity Molecular Function

GO:0015267 channel activity Molecular Function

KEGG gene cross-reference

ath:AT4G18910

ath:AT5G37810

ath:AT5G37820

dosa:Os05g0205000

osa:4338071

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.418

Rank 1 · TkA02G478780 · TK1151

Lysosome / Vacuole0.138

Rank 2 · TkA02G478780 · TK1151

Mitochondrion0.116

Rank 3 · TkA02G478780 · TK1151

Cytoplasm0.112

Rank 4 · TkA02G478780 · TK1151

Cell membrane0.065

Rank 5 · TkA02G478780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP21-114 aa

PF18916Lycopene_cyc48-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G478780	`PF00230`	MIP	21	114	7.7e-20	72.3
TkA02G478780	`PF18916`	Lycopene_cyc	48	105	0.61	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W036`	Arabidopsis thaliana	sp\|Q8W036\|NIP42_ARATH Probable aquaporin NIP4-2	49.600%	Swiss-Prot	Medium
`Q9FIZ9`	Arabidopsis thaliana	sp\|Q9FIZ9\|NIP41_ARATH Putative aquaporin NIP4-1	53.300%	Swiss-Prot	High
`Q8LFP7`	Arabidopsis thaliana	sp\|Q8LFP7\|NIP12_ARATH Aquaporin NIP1-2	49.500%	Swiss-Prot	Medium
`Q0DK16`	Oryza sativa subsp. japonica	sp\|Q0DK16\|NIP13_ORYSJ Aquaporin NIP1-3	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card