RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G043030
Reference: TK1151 Chr: Chr02 Coordinates: 10925764-10948213 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

8132 bp · TkA02G043030|TK1151|cDNA

CTTGTCCAAATTTAAATAATCAAAGCGCCATAGACGTTTTTACACACACCTACCAAATTTCAAATTTCTCCACAAATTCAAACGACAAAACCCCCTCATTATGGTTTCTTGATGTGTGTGAGAGAGATTGAGGGCTAGAGTGAGAGAAGGAGAGATTTTGAATCAACATTCATTATTTTTCATGTAGAGCTAAAAACACATGTAATCCTACAGTTTGTACTTTGTATTGATTGTTTTGGAACAATTGCAGGAGTTGGTCG...

CDS

Download CDS FASTA

7653 bp · TkA02G043030|TK1151|CDS

ATGTTGAGAGATCTCAATTTCTTGCGTCGGAATTCTGGTAAAAACACTGATACCGATGAACCTGAAAATGTGCCTGTAAACGGCAAATTTCATGAATCATCAGTAGCTCAGATGGGTGCCGACTCTTCATCAAGACCACCATTGAGTGCAATTCGAGACCCTGTGCAAAACCCTAGCAAGCGTGAACAGGAATCAGCGTTTAAAAACACGAAACTCGATAGAACGCCCACTAAGGTCAATGCTACGATGAAAACTCCAGA...

Protein

Download Protein FASTA

2550 aa · TkA02G043030|TK1151|PROTEIN

MLRDLNFLRRNSGKNTDTDEPENVPVNGKFHESSVAQMGADSSSRPPLSAIRDPVQNPSKREQESAFKNTKLDRTPTKVNATMKTPEKQGGLARNRYGWASDSKHEVKNGNMNMNITTSTPRSCRTVGRAVSSGYSECNLTPNTQCNSTQNTPTKSVNKPPNPGLSSRPPISGGVRNNGSFAALSRGFQNTYPHVNTIEVPHFDLKEDPSFWMDHNVQVLIRIRPLNNMELSAQGYNRCLKQDSAQCLTWVGQPETRFKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G043030
TK1151 IDTkA02G043030
OH-1004 IDLXL04_017448
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)94.600
Protein coverage (%)TK1151 100.000 / OH-1004 99.048
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G043030
LocationChr02:10925764-10948213 (+)
DescriptionSimilar to KIN12D: Kinesin-like protein KIN-12D
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g19050 Involved in the spatial control of cytokinesis by a proper phragmoplast guidance.
Two kinesins are involved in the spatial control of cytokinesis in Arabidopsis thaliana.2006 · DOI: 10.1016/j.cub.2006.03.034
At3g17360 Involved in the spatial control of cytokinesis by a proper phragmoplast guidance.
Two kinesins are involved in the spatial control of cytokinesis in Arabidopsis thaliana.2006 · DOI: 10.1016/j.cub.2006.03.034
Tangled localization at the cortical division site of plant cells occurs by several mechanisms.2011 · DOI: 10.1242/jcs.073676

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0590500 Kinesin-like protein KIN-12F. No verified direct reference in this release
Os07g0638000 Kinesin-like protein KIN-12E. No verified direct reference in this release
UniProt: Q75LL2 Kinesin-like protein KIN-12G. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017448 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000281 mitotic cytokinesis Biological Process
GO:0000911 cytokinesis by cell plate formation Biological Process
GO:0007018 microtubule-based movement Biological Process
GO:0080175 phragmoplast microtubule organization Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005874 microtubule Cellular Component
GO:0009524 phragmoplast Cellular Component
GO:0032153 cell division site Cellular Component
GO:0003777 microtubule motor activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0008017 microtubule binding Molecular Function
KEGG gene cross-reference
ath:AT3G17360
ath:AT3G19050
dosa:Os12g0590500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.645
Rank 1 · TkA02G043030 · TK1151
Nucleus0.241
Rank 2 · TkA02G043030 · TK1151
Cell membrane0.134
Rank 3 · TkA02G043030 · TK1151
Golgi apparatus0.099
Rank 4 · TkA02G043030 · TK1151
Endoplasmic reticulum0.047
Rank 5 · TkA02G043030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd216-368 aa
PF00225Kinesin222-553 aa
PF30550RR_cyano_HH639-665 aa
PF15081DUF4548754-849 aa
PF16796Microtub_bd931-970 aa
PF00225Kinesin935-980 aa
PF16796Microtub_bd1050-1113 aa
PF00225Kinesin1085-1140 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G043030PF16796Microtub_bd2163685.6e-2175.8
TkA02G043030PF00225Kinesin2225536.7e-111371.1
TkA02G043030PF30550RR_cyano_HH6396650.1512.6
TkA02G043030PF15081DUF45487548490.1212.9
TkA02G043030PF16796Microtub_bd9319705.6e-2175.8
TkA02G043030PF00225Kinesin9359806.7e-111371.1
TkA02G043030PF16796Microtub_bd105011135.6e-2175.8
TkA02G043030PF00225Kinesin108511406.7e-111371.1
TkA02G043030PF00225Kinesin139214636.7e-111371.1
TkA02G043030PF13613HTH_Tnp_4147914890.03714.4
TkA02G043030PF07756DUF1612150615410.000521.0
TkA02G043030PF13613HTH_Tnp_4152915430.03714.4
TkA02G043030PF13613HTH_Tnp_4157815890.03714.4
TkA02G043030PF07756DUF1612161216620.000521.0
TkA02G043030PF13613HTH_Tnp_4164916590.03714.4
TkA02G043030PF07756DUF1612168017260.000521.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q27IK6Arabidopsis thalianasp|Q27IK6|KN12D_ARATH Kinesin-like protein KIN-12D38.500%Swiss-ProtMedium
Q27IK7Arabidopsis thalianasp|Q27IK7|KN12C_ARATH Kinesin-like protein KIN-12C52.300%Swiss-ProtMedium
B9GE13Oryza sativa subsp. japonicasp|B9GE13|KN12F_ORYSJ Kinesin-like protein KIN-12F36.000%Swiss-ProtMedium
B9FUF9Oryza sativa subsp. japonicasp|B9FUF9|KN12E_ORYSJ Kinesin-like protein KIN-12E58.800%Swiss-ProtLow
Q75LL2Oryza sativa subsp. japonicasp|Q75LL2|KN12G_ORYSJ Kinesin-like protein KIN-12G52.700%Swiss-ProtLow

JBrowse

View in Genome Browser