LXL04_017448 | RubberDandelionOmics

Gene overview

LXL04_017448

Reference: OH-1004 Chr: Chr03 Coordinates: 149517092-149529223 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7569 bp · LXL04_017448|LXL04_017448|OH1004|cDNA

ATGAAAGAGTTGAATGTTTGGTGTGGAGTTGGTCGTGGATTTGGAATAATATTTCTCACTTCGTCTTTCAGAATGTTGAGAGATCTCAATTTCTTGCGTCGGAATTCTGGTAAAAACACTGATACCGATGAACCTGAAAATGTGCCTGTAAACGGCAAATTTCATGAATCATCAGTAGCTCAGATGGGTGCCGACTCTTCATCAAGACCACCATTGAGTGCAATTCGAGACCCTGTGCAAAACCCTAGCAAGCGTGAACA...

CDS

Download CDS FASTA

7569 bp · LXL04_017448|LXL04_017448|OH1004|CDS

ATGAAAGAGTTGAATGTTTGGTGTGGAGTTGGTCGTGGATTTGGAATAATATTTCTCACTTCGTCTTTCAGAATGTTGAGAGATCTCAATTTCTTGCGTCGGAATTCTGGTAAAAACACTGATACCGATGAACCTGAAAATGTGCCTGTAAACGGCAAATTTCATGAATCATCAGTAGCTCAGATGGGTGCCGACTCTTCATCAAGACCACCATTGAGTGCAATTCGAGACCCTGTGCAAAACCCTAGCAAGCGTGAACA...

Protein

Download Protein FASTA

2522 aa · LXL04_017448|LXL04_017448|OH1004|PROTEIN

MKELNVWCGVGRGFGIIFLTSSFRMLRDLNFLRRNSGKNTDTDEPENVPVNGKFHESSVAQMGADSSSRPPLSAIRDPVQNPSKREQESAFKNTKLDRTPTKVNATMKTPEKQGGLARNRYGWASDSKNEVKNGNMNMNITTNTPRSCRTVRRAVSSGYSECNLTPNTQCNSTQNTPTKSVNKPPNPGLSSRPPISGGVRNNGSFAALSRGFQNTYPHVNTIEVPHFDLKEDPSFWMDHNVQVLIRIRPLNNMELSAQGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017448`
TK1151 ID	TkA02G043030
OH-1004 ID	LXL04_017448
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 99.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017448

Location Chr03:149517092-149529223 (-)

Description Similar to KIN12D: Kinesin-like protein KIN-12D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19050`	Involved in the spatial control of cytokinesis by a proper phragmoplast guidance.	Two kinesins are involved in the spatial control of cytokinesis in Arabidopsis thaliana.2006 · DOI: 10.1016/j.cub.2006.03.034
`At3g17360`	Involved in the spatial control of cytokinesis by a proper phragmoplast guidance.	Two kinesins are involved in the spatial control of cytokinesis in Arabidopsis thaliana.2006 · DOI: 10.1016/j.cub.2006.03.034 Tangled localization at the cortical division site of plant cells occurs by several mechanisms.2011 · DOI: 10.1242/jcs.073676

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0590500`	Kinesin-like protein KIN-12F.	No verified direct reference in this release
`Os07g0638000`	Kinesin-like protein KIN-12E.	No verified direct reference in this release
`UniProt: Q75LL2`	Kinesin-like protein KIN-12G.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017448 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0080175 phragmoplast microtubule organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0032153 cell division site Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT3G17360

ath:AT3G19050

dosa:Os12g0590500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.645

Rank 1 · LXL04_017448 · OH-1004

Nucleus0.238

Rank 2 · LXL04_017448 · OH-1004

Cell membrane0.133

Rank 3 · LXL04_017448 · OH-1004

Golgi apparatus0.101

Rank 4 · LXL04_017448 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_017448 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd240-392 aa

PF00225.30Kinesin246-577 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017448	`PF16796.12`	Microtub_bd	240	392	5.6e-21	75.8
LXL04_017448	`PF00225.30`	Kinesin	246	577	6.6e-111	371.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q27IK6`	Arabidopsis thaliana	Kinesin-like protein KIN-12D	50.917%	Swiss-Prot	weak database homology
`Q27IK7`	Arabidopsis thaliana	Kinesin-like protein KIN-12C	52.190%	Swiss-Prot	weak database homology
`B9GE13`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-12F	47.734%	Swiss-Prot	weak database homology
`B9FUF9`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-12E	58.768%	Swiss-Prot	weak database homology
`Q75LL2`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-12G	52.923%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card