TkA01G206070 | RubberDandelionOmics

Gene overview

TkA01G206070

Reference: TK1151 Chr: Chr01 Coordinates: 52472640-52473053 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA01G206070|TK1151|cDNA

ATGGAAACCTTTATAAGAAACTACCAAAATTCCTGGCAAAAGTCAATCGCCGGCTCCGGCTCCACCTCCACCTCCACCTCCAACTCATTTCTCCGATCAAAACCCACAGAGTGCACAATCTGTAAGGATGAATTCATTAAGGGCGAAAACATCAAACGGCTCCCCTGCCACCACTACTTCCACCACGAATGTATCCGCCGGTGGCTTTCATATAAGAAAAACTGCCCTATCTGCCGCCGTACAATTGTAAAGCCGAAAGT...

CDS

Download CDS FASTA

414 bp · TkA01G206070|TK1151|CDS

ATGGAAACCTTTATAAGAAACTACCAAAATTCCTGGCAAAAGTCAATCGCCGGCTCCGGCTCCACCTCCACCTCCACCTCCAACTCATTTCTCCGATCAAAACCCACAGAGTGCACAATCTGTAAGGATGAATTCATTAAGGGCGAAAACATCAAACGGCTCCCCTGCCACCACTACTTCCACCACGAATGTATCCGCCGGTGGCTTTCATATAAGAAAAACTGCCCTATCTGCCGCCGTACAATTGTAAAGCCGAAAGT...

Protein

Download Protein FASTA

137 aa · TkA01G206070|TK1151|PROTEIN

METFIRNYQNSWQKSIAGSGSTSTSTSNSFLRSKPTECTICKDEFIKGENIKRLPCHHYFHHECIRRWLSYKKNCPICRRTIVKPKVAIPRSLPQQSCGKVEWVEHKQPVVALFFYQMMDLYEAFFGSGSMSTYSLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G206070`
TK1151 ID	TkA01G206070
OH-1004 ID	LXL04_004077
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 27.565 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G206070`
Location	Chr01:52472640-52473053 (+)
Description	Similar to At3g19950: E3 ubiquitin-protein ligase RING1-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004077` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0035519 protein K29-linked ubiquitination Biological Process GO:0044314 protein K27-linked ubiquitination Biological Process GO:1905168 positive regulation of double-strand break repair via homologous recombination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	ath:AT3G19950 xla:432033 xtr:448402 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · TkA01G206070 · TK1151

Nucleus0.395

Rank 2 · TkA01G206070 · TK1151

Cell membrane0.131

Rank 3 · TkA01G206070 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkA01G206070 · TK1151

Mitochondrion0.095

Rank 5 · TkA01G206070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06712DUF119917-29 aa

PF13771zf-HC5HC2H21-67 aa

PF13832zf-HC5HC2H_233-67 aa

PF00130C1_133-67 aa

PF03854zf-P1133-42 aa

PF13920zf-C3HC4_336-82 aa

PF29452FAR1_N36-79 aa

PF14446Prok-RING_136-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G206070	`PF06712`	DUF1199	17	29	0.53	11.1
TkA01G206070	`PF13771`	zf-HC5HC2H	21	67	0.33	11.9
TkA01G206070	`PF13832`	zf-HC5HC2H_2	33	67	0.21	12.5
TkA01G206070	`PF00130`	C1_1	33	67	0.57	10.8
TkA01G206070	`PF03854`	zf-P11	33	42	1.9	8.9
TkA01G206070	`PF13920`	zf-C3HC4_3	36	82	9.5e-07	29.2
TkA01G206070	`PF29452`	FAR1_N	36	79	0.005	17.5
TkA01G206070	`PF14446`	Prok-RING_1	36	67	0.0065	17.3
TkA01G206070	`PF17120`	zf-RING_16	36	76	0.021	15.1
TkA01G206070	`PF13639`	zf-RING_2	37	79	7.1e-15	55.7
TkA01G206070	`PF13923`	zf-C3HC4_2	37	78	3.5e-10	40.2
TkA01G206070	`PF17123`	zf-RING_11	37	65	3.7e-09	36.8
TkA01G206070	`PF14634`	zf-RING_5	37	80	7.4e-06	26.6
TkA01G206070	`PF23555`	zf-RING_Vps41	37	78	0.01	16.1
TkA01G206070	`PF25998`	U-box_ZFPL1	37	71	0.018	16.1
TkA01G206070	`PF23413`	zf_RING_Vps8_fungal	37	44	0.055	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card