LXL04_003329 | RubberDandelionOmics

Gene overview

LXL04_003329

Reference: OH-1004 Chr: Chr01 Coordinates: 74901252-74913572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5493 bp · LXL04_003329|LXL04_003329|OH1004|cDNA

ATGGCGACATCAACAGTATCATCCTCTTCGTCATATTTCACAGGGAAATCAGATGAAGAAATCGAGGAAATGCTTGATCGAATGCTTACTCGATTGGCCATGTGCGATGACCCCCAACTAGAAAACTTGCTCCTCAAGCTACTTCCTGTTACCATTTTCTCGCTCTCCCGTCCGTCTTCTGCCGTCAGGACCAAGGTATTTTTCATCGATTTCACTCTTCCTATCCAGTTGGTGTCTGTGATGGAAATCCTAAGCCATGT...

CDS

Download CDS FASTA

5493 bp · LXL04_003329|LXL04_003329|OH1004|CDS

ATGGCGACATCAACAGTATCATCCTCTTCGTCATATTTCACAGGGAAATCAGATGAAGAAATCGAGGAAATGCTTGATCGAATGCTTACTCGATTGGCCATGTGCGATGACCCCCAACTAGAAAACTTGCTCCTCAAGCTACTTCCTGTTACCATTTTCTCGCTCTCCCGTCCGTCTTCTGCCGTCAGGACCAAGGTATTTTTCATCGATTTCACTCTTCCTATCCAGTTGGTGTCTGTGATGGAAATCCTAAGCCATGT...

Protein

Download Protein FASTA

1830 aa · LXL04_003329|LXL04_003329|OH1004|PROTEIN

MATSTVSSSSSYFTGKSDEEIEEMLDRMLTRLAMCDDPQLENLLLKLLPVTIFSLSRPSSAVRTKVFFIDFTLPIQLVSVMEILSHVNKRVKHQQQIGLPLEELWELYMEANTAPMVRNFCIVYIEMAFDRVTKEKKENIAPTMIANISKLPPQHQDIVFRIVTKVIGECHSSKINDEIAAKYKLITGSQDKEMFVEFCLHTLLYQPPSTSGGSSPGLSVSQSNRVAGKSPLNHDMLLVRKLGLLNVIDVMDLPAELVYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003329`
TK1151 ID	TkA01G373200
OH-1004 ID	LXL04_003329
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_003329`
Location	Chr01:74901252-74913572 (+)
Description	Similar to ECPAS: Proteasome adapter and scaffold protein ECM29
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003329` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0036503 ERAD pathway Biological Process GO:0043248 proteasome assembly Biological Process GO:0000502 proteasome complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0005771 multivesicular body Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0005813 centrosome Cellular Component
KEGG gene cross-reference	dme:Dmel_CG8858 hsa:23392 mmu:230249 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · LXL04_003329 · OH-1004

Nucleus0.360

Rank 2 · LXL04_003329 · OH-1004

Golgi apparatus0.139

Rank 3 · LXL04_003329 · OH-1004

Lysosome / Vacuole0.102

Rank 4 · LXL04_003329 · OH-1004

Cell membrane0.093

Rank 5 · LXL04_003329 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13001.14ECM29_N25-520 aa

PF23702.3ARM_ECM29640-734 aa

PF24987.2HEAT_EF3_N1066-1198 aa

PF23271.2HEAT_GCN11080-1197 aa

PF24492.2HEAT_ECM291266-1427 aa

PF23731.2ARM_ECM29_C1595-1751 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003329	`PF13001.14`	ECM29_N	25	520	9.3e-127	424.5
LXL04_003329	`PF23702.3`	ARM_ECM29	640	734	5.3e-12	46.5
LXL04_003329	`PF24987.2`	HEAT_EF3_N	1066	1198	6.2e-13	49.8
LXL04_003329	`PF23271.2`	HEAT_GCN1	1080	1197	2e-14	54.9
LXL04_003329	`PF24492.2`	HEAT_ECM29	1266	1427	2.3e-55	187.8
LXL04_003329	`PF23731.2`	ARM_ECM29_C	1595	1751	5.4e-08	34.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card