LXL04_030018 | RubberDandelionOmics

Gene overview

LXL04_030018

Reference: OH-1004 Chr: Chr06 Coordinates: 105829685-105830029 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · LXL04_030018|LXL04_030018|OH1004|cDNA

TTAGCATATTCGATGGAGGTGAATGAGAAATGTGATGTCTATAGTTTTGGGATTGTGACGCTTGAGGTGATAATGGGAGAGCATCCAAGAGATTTGACTATGTCCAAGTTAAGTGTTGAAGAGTTACGGACACACGTTGTTCTTGACCAACGACTCAACGTGCCTATGGGTCAAGTTGCGGAAGTAGTGAACCAAATTGTAGAGCTTGCTTTTGCATGTTTAAACATCAACCCTCGCTCTCGGCCATTGATGCTACATGT...

CDS

Download CDS FASTA

333 bp · LXL04_030018|LXL04_030018|OH1004|CDS

ATGGAGGTGAATGAGAAATGTGATGTCTATAGTTTTGGGATTGTGACGCTTGAGGTGATAATGGGAGAGCATCCAAGAGATTTGACTATGTCCAAGTTAAGTGTTGAAGAGTTACGGACACACGTTGTTCTTGACCAACGACTCAACGTGCCTATGGGTCAAGTTGCGGAAGTAGTGAACCAAATTGTAGAGCTTGCTTTTGCATGTTTAAACATCAACCCTCGCTCTCGGCCATTGATGCTACATGTTTCAAAAAAATT...

Protein

Download Protein FASTA

110 aa · LXL04_030018|LXL04_030018|OH1004|PROTEIN

MEVNEKCDVYSFGIVTLEVIMGEHPRDLTMSKLSVEELRTHVVLDQRLNVPMGQVAEVVNQIVELAFACLNINPRSRPLMLHVSKKLSTIIPSVTRQLKKQESTSSCQKQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030018`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030018

Location Chr06:105829685-105830029 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35710`	Probable leucine-rich repeat receptor-like protein kinase At1g35710.	No verified direct reference in this release
`At4g08850`	Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975 Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At1g78530`	Receptor-like serine/threonine-protein kinase At1g78530.	No verified direct reference in this release
`At5g62230`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ER and ERL2.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0007165 signal transduction Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

KEGG gene cross-reference

ath:AT1G35710

ath:AT1G78530

ath:AT4G08850

ath:AT5G48940

ath:AT5G62230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.562

Rank 1 · LXL04_030018 · OH-1004

Cytoplasm0.335

Rank 2 · LXL04_030018 · OH-1004

Nucleus0.221

Rank 3 · LXL04_030018 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_030018 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_030018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr2-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030018	`PF07714.24`	PK_Tyr_Ser-Thr	2	87	1.5e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LP24`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At1g35710	46.667%	Swiss-Prot	moderate database homology
`Q8VZG8`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 2	46.739%	Swiss-Prot	moderate database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	34.783%	Swiss-Prot	moderate database homology
`Q9SYM9`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase At1g78530	37.895%	Swiss-Prot	moderate database homology
`C0LGW6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase ERL1	31.897%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card