LXL04_029907 | RubberDandelionOmics

Gene overview

LXL04_029907

Reference: OH-1004 Chr: Chr06 Coordinates: 103182207-103183499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1128 bp · LXL04_029907|LXL04_029907|OH1004|cDNA

ATGAAGAGACACCGACCCATCCCGTCGCCGCCGTCAATAACCACGGCTACTCGAGAACCCATCCTCTCAAAAATCACCGCAAACAATTCCATATCCTCATACTACTCTTCCAAGAAACCTAGAAAACCCCTTCTTTCCGACCTCAAAACCCCCAAACGGGTAACCCTAAATCTAAACAAATCAGAGCTCTTTTTACCACTCACATTCCCCACCGGGCAAACATTCAGGTGGAAACAAACATCCCCTTCTCAATACACAGG...

CDS

Download CDS FASTA

1128 bp · LXL04_029907|LXL04_029907|OH1004|CDS

ATGAAGAGACACCGACCCATCCCGTCGCCGCCGTCAATAACCACGGCTACTCGAGAACCCATCCTCTCAAAAATCACCGCAAACAATTCCATATCCTCATACTACTCTTCCAAGAAACCTAGAAAACCCCTTCTTTCCGACCTCAAAACCCCCAAACGGGTAACCCTAAATCTAAACAAATCAGAGCTCTTTTTACCACTCACATTCCCCACCGGGCAAACATTCAGGTGGAAACAAACATCCCCTTCTCAATACACAGG...

Protein

Download Protein FASTA

375 aa · LXL04_029907|LXL04_029907|OH1004|PROTEIN

MKRHRPIPSPPSITTATREPILSKITANNSISSYYSSKKPRKPLLSDLKTPKRVTLNLNKSELFLPLTFPTGQTFRWKQTSPSQYTGVVGSHLVSLLQLQDANGTDVAYTFHNTPISNQSAAKSALLDFLNMSICLSDLWKEFSASDQRFAELAEHLSGARVLRQDPLECLIQFICSSNNNIKRITQMVDFISSLGNHLGVVEGIEFHEFPTLDRLSKVSEEELRKAGFGYRAKYITGTVQSLQSKPGGGEAWLASLRKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029907`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029907

Location Chr06:103182207-103183499 (-)

Description Similar to OGG1: N-glycosylase/DNA lyase OGG1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21710`	Involved in repair of DNA damaged by oxidation by incising DNA at 8-oxoG residues.	A functional OGG1 homologue from Arabidopsis thaliana.2001 · DOI: 10.1007/s004380000414 An OGG1 orthologue encoding a functional 8-oxoguanine DNA glycosylase/lyase in Arabidopsis thaliana.2001 · DOI: 10.1023/a:1013644026132 Arabidopsis thaliana Ogg1 protein excises 8-hydroxyguanine and 2,6-diamino-4-hydroxy-5-formamidopyrimidine from oxidatively damaged DNA containing multiple lesions.2003 · DOI: 10.1021/bi027226u Overexpression of AtOGG1, a DNA glycosylase/AP lyase, enhances seed longevity and abiotic stress tolerance in Arabidopsis.2012 · DOI: 10.1093/jxb/ers093

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029907 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006285 base-excision repair, AP site formation Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009314 response to radiation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0032355 response to estradiol Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

KEGG gene cross-reference

ath:AT1G21710

dme:Dmel_CG1795

hsa:4968

mmu:18294

rno:81528

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.652

Rank 1 · LXL04_029907 · OH-1004

Plastid0.173

Rank 2 · LXL04_029907 · OH-1004

Cytoplasm0.171

Rank 3 · LXL04_029907 · OH-1004

Mitochondrion0.158

Rank 4 · LXL04_029907 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_029907 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07934.19OGG_N56-171 aa

PF00730.32HhH-GPD172-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029907	`PF07934.19`	OGG_N	56	171	4.3e-25	88.9
LXL04_029907	`PF00730.32`	HhH-GPD	172	309	4e-10	40.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNY7`	Arabidopsis thaliana	N-glycosylase/DNA lyase OGG1	61.600%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card